G protein alpha Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: G protein alpha Antibody [NBP1-89754] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: G protein alpha Antibody [NBP1-89754] - Staining of human pancreas shows strong cytoplasmic positivity in islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G protein alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNAS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
G protein alpha Protein (NBP1-89754PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for G protein alpha Antibody

  • Adenylate cyclase-stimulating G alpha protein
  • AHO
  • Alternative gene product encoded by XL-exon
  • Extra large alphas protein
  • GNAS complex locus
  • GNAS1GSA
  • GNASXL
  • GPSAC20orf45
  • GSP
  • guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide 1
  • guanine nucleotide regulatory protein
  • guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
  • MGC33735
  • NESP
  • NESP55
  • neuroendocrine secretory protein
  • PHP1A
  • PHP1B
  • PHP1C
  • POH
  • protein ALEX
  • SCG6
  • secretogranin VI
  • XLalphas

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
AF2569
Species: Hu
Applications: WB, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-92467
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for G protein alpha Antibody (NBP1-89754) (0)

There are no publications for G protein alpha Antibody (NBP1-89754).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G protein alpha Antibody (NBP1-89754) (0)

There are no reviews for G protein alpha Antibody (NBP1-89754). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for G protein alpha Antibody (NBP1-89754) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G protein alpha Products

Bioinformatics Tool for G protein alpha Antibody (NBP1-89754)

Discover related pathways, diseases and genes to G protein alpha Antibody (NBP1-89754). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G protein alpha Antibody (NBP1-89754)

Discover more about diseases related to G protein alpha Antibody (NBP1-89754).
 

Pathways for G protein alpha Antibody (NBP1-89754)

View related products by pathway.

PTMs for G protein alpha Antibody (NBP1-89754)

Learn more about PTMs related to G protein alpha Antibody (NBP1-89754).
 

Research Areas for G protein alpha Antibody (NBP1-89754)

Find related products by research area.

Blogs on G protein alpha

There are no specific blogs for G protein alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G protein alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAS