G protein alpha Antibody

Images

 
Immunohistochemistry: G protein alpha Antibody [NBP1-89752] - Staining of human fallopian tube shows distinct positivity in cilia.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

G protein alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNAS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
G protein alpha Protein (NBP1-89752PEP)

Alternate Names for G protein alpha Antibody

  • Adenylate cyclase-stimulating G alpha protein
  • AHO
  • Alternative gene product encoded by XL-exon
  • Extra large alphas protein
  • GNAS complex locus
  • GNAS1GSA
  • GNASXL
  • GPSAC20orf45
  • GSP
  • guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide 1
  • guanine nucleotide regulatory protein
  • guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
  • MGC33735
  • NESP
  • NESP55
  • neuroendocrine secretory protein
  • PHP1A
  • PHP1B
  • PHP1C
  • POH
  • protein ALEX
  • SCG6
  • secretogranin VI
  • XLalphas

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7665
Species: Hu
Applications: WB, IHC
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
AF2569
Species: Hu
Applications: WB, ICC
NBP1-92467
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-14041
Species: Hu
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-90927
Species: Hu
Applications: WB, IHC, IHC-P
MAB1489
Species: Hu
Applications: WB

Publications for G protein alpha Antibody (NBP1-89752) (0)

There are no publications for G protein alpha Antibody (NBP1-89752).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G protein alpha Antibody (NBP1-89752) (0)

There are no reviews for G protein alpha Antibody (NBP1-89752). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for G protein alpha Antibody (NBP1-89752) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G protein alpha Antibody Products

Related Products by Gene

Bioinformatics Tool for G protein alpha Antibody (NBP1-89752)

Discover related pathways, diseases and genes to G protein alpha Antibody (NBP1-89752). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G protein alpha Antibody (NBP1-89752)

Discover more about diseases related to G protein alpha Antibody (NBP1-89752).
 

Pathways for G protein alpha Antibody (NBP1-89752)

View related products by pathway.

PTMs for G protein alpha Antibody (NBP1-89752)

Learn more about PTMs related to G protein alpha Antibody (NBP1-89752).

Blogs on G protein alpha

There are no specific blogs for G protein alpha, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol GNAS

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89752 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought