We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

G protein alpha Antibody - BSA Free

Images

 
Western Blot: G protein alpha Antibody [NBP1-58349] - Sample Tissue: Human Lung Tumor Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: G protein alpha Antibody [NBP1-58349] - Paraffin Embedded Tissue: Human Pancreas Antibody Concentration: 5 ug/ml
Western Blot: G protein alpha Antibody [NBP1-58349] - Titration: 1 ug/ml Positive Control: MCF-7 whole cell lysates.
Western Blot: G protein alpha Antibody [NBP1-58349] - Sample Tissue: MCF7 Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: ...read more
Immunohistochemistry: G protein alpha Antibody [NBP1-58349] - Analysis of human thyroid after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry: G protein alpha Antibody [NBP1-58349] - Lanes: Lane 1 : INS1 lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Donkey anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Gene name: ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

G protein alpha Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to GNAS(GNAS complex locus) The peptide sequence was selected from the N terminal of GNAS. Peptide sequence VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNAS
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for G protein alpha Antibody - BSA Free

  • Adenylate cyclase-stimulating G alpha protein
  • AHO
  • Alternative gene product encoded by XL-exon
  • Extra large alphas protein
  • GNAS complex locus
  • GNAS1GSA
  • GNASXL
  • GPSAC20orf45
  • GSP
  • guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide 1
  • guanine nucleotide regulatory protein
  • guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
  • MGC33735
  • NESP
  • NESP55
  • neuroendocrine secretory protein
  • PHP1A
  • PHP1B
  • PHP1C
  • POH
  • protein ALEX
  • SCG6
  • secretogranin VI
  • XLalphas

Background

Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript exists, and this antisense transcript and one of the transcripts are paternally expressed, produce noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65676
Species: Hu
Applications: ELISA, IHC, IHC-Fr,  IHC-P
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB1455
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-92467
Species: Hu
Applications: ICC/IF,  IHC-P, Simple Western, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF1067
Applications: ELISA, IHC, Neut, WB
AF1638
Applications: ICC, Simple Western, WB
NBP1-90927
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-58349
Species: Hu, Rt
Applications: WB, IHC

Publications for G protein alpha Antibody (NBP1-58349) (0)

There are no publications for G protein alpha Antibody (NBP1-58349).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G protein alpha Antibody (NBP1-58349) (0)

There are no reviews for G protein alpha Antibody (NBP1-58349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G protein alpha Antibody (NBP1-58349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G protein alpha Products

Research Areas for G protein alpha Antibody (NBP1-58349)

Find related products by research area.

Blogs on G protein alpha

There are no specific blogs for G protein alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G protein alpha Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAS
Uniprot