G protein alpha Antibody - BSA Free

Western Blot: G protein alpha Antibody [NBP1-58349] - Sample Tissue: Human Lung Tumor Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: G protein alpha Antibody [NBP1-58349] - Paraffin Embedded Tissue: Human Pancreas Antibody Concentration: 5 ug/ml

Western Blot: G protein alpha Antibody [NBP1-58349] - Titration: 1 ug/ml Positive Control: MCF-7 whole cell lysates.

Western Blot: G protein alpha Antibody [NBP1-58349] - Sample Tissue: MCF7 Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%

Immunohistochemistry: G protein alpha Antibody [NBP1-58349] - Analysis of human thyroid after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.

Immunohistochemistry: G protein alpha Antibody [NBP1-58349] - Lanes: Lane 1 : INS1 lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Donkey anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Gene name: GNAS Submitted by: Olivier Costa, Diabetes research center VUB.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

G protein alpha Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GNAS(GNAS complex locus) The peptide sequence was selected from the N terminal of GNAS. Peptide sequence VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNAS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for G protein alpha Antibody - BSA Free

• Adenylate cyclase-stimulating G alpha protein
• AHO
• Alternative gene product encoded by XL-exon
• Extra large alphas protein
• GNAS complex locus
• GNAS1GSA
• GNASXL
• GPSAC20orf45
• GSP
• guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide 1
• guanine nucleotide regulatory protein
• guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
• MGC33735
• NESP
• NESP55
• neuroendocrine secretory protein
• PHP1A
• PHP1B
• PHP1C
• POH
• protein ALEX
• SCG6
• secretogranin VI
• XLalphas

Background

Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript exists, and this antisense transcript and one of the transcripts are paternally expressed, produce noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNAS
• Uniprot:
  • P63092(Human)