Recombinant Human Fumarylacetoacetate hydrolase Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Fumarylacetoacetate hydrolase Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-70 of Human Fumarylacetoacetate hydrolase

Source: Wheat Germ

Amino Acid Sequence: MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQPTLNSF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FAH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
33.33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Fumarylacetoacetate hydrolase Protein

  • beta-diketonase
  • EC 3.7.1.2
  • FAA
  • fumarylacetoacetase
  • fumarylacetoacetate hydrolase (fumarylacetoacetase)
  • Fumarylacetoacetate hydrolase

Background

This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NB100-2564
Species: Hu
Applications: WB
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
H00002954-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-89158
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-33488
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO

Publications for Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01) (0)

There are no publications for Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01) (0)

There are no reviews for Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fumarylacetoacetate hydrolase Products

Bioinformatics Tool for Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01)

Discover related pathways, diseases and genes to Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01)

Discover more about diseases related to Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01).
 

Pathways for Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01)

View related products by pathway.

PTMs for Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01)

Learn more about PTMs related to Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01).
 

Research Areas for Fumarylacetoacetate hydrolase Partial Recombinant Protein (H00002184-Q01)

Find related products by research area.

Blogs on Fumarylacetoacetate hydrolase

There are no specific blogs for Fumarylacetoacetate hydrolase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Fumarylacetoacetate hydrolase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FAH