FRMD4A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FRMD4A Antibody [NBP1-90807] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FRMD4A Antibody [NBP1-90807] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: FRMD4A Antibody [NBP1-90807] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: FRMD4A Antibody [NBP1-90807] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: FRMD4A Antibody [NBP1-90807] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: FRMD4A Antibody [NBP1-90807] - Staining of human lymphoid tissues shows strong nuclear positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FRMD4A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGAHDKGAGRAAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSA
Specificity
Specificity of human FRMD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FRMD4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FRMD4A Protein (NBP1-90807PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FRMD4A Antibody

  • bA295P9.4
  • FERM domain containing 4A
  • FERM domain-containing protein 4A
  • FLJ10210
  • FRMD4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33694
Species: Hu
Applications: WB, ICC/IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP2-67165
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87581
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS261
Species: Hu
Applications: WB (-), IHC, IHC-P, ICC
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3014
Species: Hu
Applications: WB, IHC, Block
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-81763
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KO
NBP2-45788
Species: Hu
Applications: WB, IHC
NBP2-32661
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FRMD4A Antibody (NBP1-90807) (0)

There are no publications for FRMD4A Antibody (NBP1-90807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRMD4A Antibody (NBP1-90807) (0)

There are no reviews for FRMD4A Antibody (NBP1-90807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FRMD4A Antibody (NBP1-90807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FRMD4A Products

Array NBP1-90807

Bioinformatics Tool for FRMD4A Antibody (NBP1-90807)

Discover related pathways, diseases and genes to FRMD4A Antibody (NBP1-90807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRMD4A Antibody (NBP1-90807)

Discover more about diseases related to FRMD4A Antibody (NBP1-90807).
 

Pathways for FRMD4A Antibody (NBP1-90807)

View related products by pathway.

Blogs on FRMD4A

There are no specific blogs for FRMD4A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FRMD4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FRMD4A