Homez Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Homez Antibody [NBP2-32661] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry: Homez Antibody [NBP2-32661] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Homez Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SSSFQVLANGATAASKPLQPLGCVPQSVSPSEQALPPHLEPAWPQGLRHNSVPGRVGPTEYLSPDMQRQRKTKRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOMEZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
Homez Protein (NBP2-32661PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Homez Antibody

  • homeobox and leucine zipper encoding
  • homeobox and leucine zipper protein Homez
  • KIAA1443Homeodomain leucine zipper-containing factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Homez Antibody (NBP2-32661) (0)

There are no publications for Homez Antibody (NBP2-32661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Homez Antibody (NBP2-32661) (0)

There are no reviews for Homez Antibody (NBP2-32661). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Homez Antibody (NBP2-32661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Homez Antibody Products

Related Products by Gene

Bioinformatics Tool for Homez Antibody (NBP2-32661)

Discover related pathways, diseases and genes to Homez Antibody (NBP2-32661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Homez Antibody (NBP2-32661)

Discover more about diseases related to Homez Antibody (NBP2-32661).
 

Pathways for Homez Antibody (NBP2-32661)

View related products by pathway.

Blogs on Homez

There are no specific blogs for Homez, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Homez Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOMEZ

Customers Who Bought This Also Bought