Frizzled-10 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Frizzled-10 Antibody - BSA Free (NBP1-85753) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FZD10 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Frizzled-10 Antibody - BSA Free
Background
Frizzled-10 (FZD10) is a Frizzled Receptor that mediates Wnt signaling. It is expressed during development in embryonic limbs, neural tube, and central nervous system. FZD10 has been reported to be expressed in brain, embryo, kidney, liver, lung, pancreas, placenta, skeletal muscle, spinal cord, and testis. ESTs have been isolated from brain, ear, heart/melanocyte/uterus, and kidney libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: IHC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu
Applications: IHC
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for Frizzled-10 Antibody (NBP1-85753) (0)
There are no publications for Frizzled-10 Antibody (NBP1-85753).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Frizzled-10 Antibody (NBP1-85753) (0)
There are no reviews for Frizzled-10 Antibody (NBP1-85753).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Frizzled-10 Antibody (NBP1-85753) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Frizzled-10 Products
Research Areas for Frizzled-10 Antibody (NBP1-85753)
Find related products by research area.
|
Blogs on Frizzled-10