Frizzled-10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Frizzled-10 Antibody [NBP1-85753] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Frizzled-10 Antibody [NBP1-85753] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Frizzled-10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV
Specificity
Specificity of human Frizzled-10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FZD10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Frizzled-10 Antibody

  • CD350 antigen
  • CD350
  • frizzled (Drosophila) homolog 10
  • frizzled homolog 10 (Drosophila)
  • Frizzled10
  • Frizzled-10
  • Fz10
  • FZ-10
  • FZD10
  • FzE7
  • hFz10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16533
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF1120
Species: Mu
Applications: WB, IHC
AF1617
Species: Hu
Applications: WB
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF198
Species: Mu
Applications: WB, IHC
AF1001
Species: Mu
Applications: IHC
NBP1-20920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-2439
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1526
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
NBP2-24519
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
NBP2-75713
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3460
Species: Hu
Applications: WB, IHC
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
NBP1-85753
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Frizzled-10 Antibody (NBP1-85753) (0)

There are no publications for Frizzled-10 Antibody (NBP1-85753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frizzled-10 Antibody (NBP1-85753) (0)

There are no reviews for Frizzled-10 Antibody (NBP1-85753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Frizzled-10 Antibody (NBP1-85753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Frizzled-10 Products

Bioinformatics Tool for Frizzled-10 Antibody (NBP1-85753)

Discover related pathways, diseases and genes to Frizzled-10 Antibody (NBP1-85753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-10 Antibody (NBP1-85753)

Discover more about diseases related to Frizzled-10 Antibody (NBP1-85753).
 

Pathways for Frizzled-10 Antibody (NBP1-85753)

View related products by pathway.

PTMs for Frizzled-10 Antibody (NBP1-85753)

Learn more about PTMs related to Frizzled-10 Antibody (NBP1-85753).
 

Research Areas for Frizzled-10 Antibody (NBP1-85753)

Find related products by research area.

Blogs on Frizzled-10

There are no specific blogs for Frizzled-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frizzled-10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FZD10