FoxO1/FKHR Antibody - BSA Free

Immunohistochemistry-Paraffin: FoxO1/FKHR Antibody [NBP1-84674] - Staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry: FoxO1/FKHR Antibody [NBP1-84674] - Staining of mouse cerebral cortex shows moderate to strong positivity in more than 75 % of neurons in the visual cortex.

Immunohistochemistry-Paraffin: FoxO1/FKHR Antibody [NBP1-84674] - Staining of human stomach shows weak to moderate nuclear positivity in glandular cells.

Staining of mouse brain shows moderate to strong positivity in more than 75 % of neurons in the pons

Analysis in control (vector only transfected HEK293T lysate) and FOXO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419586).

Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FoxO1/FKHR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FoxO1/FKHR Antibody - BSA Free (NBP1-84674) is a polyclonal antibody validated for use in IHC and WB. Anti-FoxO1/FKHR Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDM
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FoxO1/FKHR Protein (NBP1-84674PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 21915096)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FoxO1/FKHR Antibody - BSA Free

• FKH1
• FKHR
• FKHRforkhead box protein O1
• forkhead box O1
• Forkhead box protein O1A
• forkhead homolog in rhabdomyosarcoma
• Forkhead in rhabdomyosarcoma
• FoxO1
• FOXO1Aforkhead, Drosophila, homolog of, in rhabdomyosarcoma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FoxO1/FKHR Antibody (NBP1-84674)(2)

Publications using NBP1-84674

• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]
• Sahu B, Laakso M, Ovaska K et al. Dual role of FoxA1 in androgen receptor binding to chromatin, androgen signalling and prostate cancer. EMBO J 2011-09-13 [PMID: 21915096]

Bioinformatics

• Gene Symbol: FOXO1