FOX2 Antibody - BSA Free

Western Blot: FOX2 Antibody [NBP1-91910] - Analysis in human cell line SH-SY5Y.

Immunocytochemistry/Immunofluorescence: FOX2 Antibody [NBP1-91910] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910] - Staining in human endometrium and pancreas tissues using anti-RBFOX2 antibody. Corresponding RBFOX2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910] - Staining of human placenta shows strong nuclear positivity in stromal cells.

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910] - Staining of human endometrium shows strong positivity in stromal cells.

Analysis in human cell line SH-SY5Y.

Staining of human pancreas shows weak to moderate nuclear positivity in islets of Langerhans.

Analysis in human endometrium and pancreas tissues using NBP1-91910 antibody. Corresponding RBFOX2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FOX2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FOX2 Antibody - BSA Free (NBP1-91910) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSL
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBFOX2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FOX2 Protein (NBP1-91910PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FOX2 Antibody - BSA Free

• dJ106I20.3
• Fox-1 homolog B
• fox-1 homologue
• FOX2Fox-2
• fxh
• hexaribonucleotide binding protein 2
• Hexaribonucleotide-binding protein 2
• HRNBP2FOX-2
• RBM9RTAHNRBP2
• Repressor of tamoxifen transcriptional activity
• RNA binding motif protein 9
• RNA binding protein fox-1 homolog 2
• RNA binding protein, fox-1 homolog (C. elegans) 2
• RNA-binding motif protein 9
• RNA-binding protein 9

Background

FOX2 is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBFOX2