Follistatin-like 1/FSTL1 Antibody


Western Blot: Follistatin-like 1/FSTL1 Antibody [NBP1-83425] - Analysis in human cell lines U2OS and Caco-2 using Anti-FSTL1 antibody. Corresponding FSTL1 RNA-seq data are presented for the same cell lines. Loading more
Immunocytochemistry/ Immunofluorescence: Follistatin-like 1/FSTL1 Antibody [NBP1-83425] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: Follistatin-like 1/FSTL1 Antibody [NBP1-83425] - Staining of human pancreas shows strong cytoplasmic positivity in islet cells.
Western Blot: Follistatin-like 1/FSTL1 Antibody [NBP1-83425] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Follistatin-like 1/FSTL1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:NFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Follistatin-like 1/FSTL1 Protein (NBP1-83425PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Follistatin-like 1/FSTL1 Antibody

  • Flik
  • FLJ50214
  • Follistatin-like 1
  • Follistatin-like protein 1
  • follistatin-related protein 1
  • Follistatin-related Protein
  • FRP
  • FRPFLJ52277
  • FSL1
  • FSTL1
  • TSC-36


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Mu
Applications: WB, IHC
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Follistatin-like 1/FSTL1 Antibody (NBP1-83425) (0)

There are no publications for Follistatin-like 1/FSTL1 Antibody (NBP1-83425).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Follistatin-like 1/FSTL1 Antibody (NBP1-83425) (0)

There are no reviews for Follistatin-like 1/FSTL1 Antibody (NBP1-83425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Follistatin-like 1/FSTL1 Antibody (NBP1-83425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Follistatin-like 1/FSTL1 Products

Bioinformatics Tool for Follistatin-like 1/FSTL1 Antibody (NBP1-83425)

Discover related pathways, diseases and genes to Follistatin-like 1/FSTL1 Antibody (NBP1-83425). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Follistatin-like 1/FSTL1 Antibody (NBP1-83425)

Discover more about diseases related to Follistatin-like 1/FSTL1 Antibody (NBP1-83425).

Pathways for Follistatin-like 1/FSTL1 Antibody (NBP1-83425)

View related products by pathway.

PTMs for Follistatin-like 1/FSTL1 Antibody (NBP1-83425)

Learn more about PTMs related to Follistatin-like 1/FSTL1 Antibody (NBP1-83425).

Blogs on Follistatin-like 1/FSTL1

There are no specific blogs for Follistatin-like 1/FSTL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Follistatin-like 1/FSTL1 Antibody and receive a gift card or discount.


Gene Symbol FSTL1