FNDC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FNDC1 Antibody [NBP2-48602] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: FNDC1 Antibody [NBP2-48602] - Staining of human cerebral cortex shows strong nuclear membranous positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FNDC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ECYAEEDEFSGLETDTAVPTEEAYVIYDEDYEFETSRPPTTTEPSTTATTPRVIPEEGAISSFPEEEFDLAGRKRFVAPYVTYLNKDPSAPCSLTDALD
Specificity
Specificity of human FNDC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FNDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FNDC1 Recombinant Protein Antigen (NBP2-48602PEP)

Reactivity Notes

Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FNDC1 Antibody

  • bA243O10.1
  • dJ322A24.1
  • expressed in synovial lining protein
  • fibronectin type III domain containing 1
  • fibronectin type III domain containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58951
Species: Hu
Applications: ICC/IF
NBP2-38220
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58490
Species: Hu
Applications: ICC/IF
NBP1-33479
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84702
Species: Hu
Applications: IHC, IHC-P
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47404
Species: Hu
Applications: IHC, IHC-P
NBP2-48602
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FNDC1 Antibody (NBP2-48602) (0)

There are no publications for FNDC1 Antibody (NBP2-48602).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FNDC1 Antibody (NBP2-48602) (0)

There are no reviews for FNDC1 Antibody (NBP2-48602). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FNDC1 Antibody (NBP2-48602) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-48602

Bioinformatics Tool for FNDC1 Antibody (NBP2-48602)

Discover related pathways, diseases and genes to FNDC1 Antibody (NBP2-48602). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FNDC1 Antibody (NBP2-48602)

Discover more about diseases related to FNDC1 Antibody (NBP2-48602).
 

Pathways for FNDC1 Antibody (NBP2-48602)

View related products by pathway.

PTMs for FNDC1 Antibody (NBP2-48602)

Learn more about PTMs related to FNDC1 Antibody (NBP2-48602).

Blogs on FNDC1

There are no specific blogs for FNDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FNDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FNDC1