Western Blot: PLC-beta 1 Antibody [NBP2-38220] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma
Orthogonal Strategies: Immunohistochemistry-Paraffin: PLC-beta 1 Antibody [NBP2-38220] - Staining in human cerebral cortex and pancreas tissues using anti-PLCB1 antibody. Corresponding PLCB1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: PLC-beta 1 Antibody [NBP2-38220] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: PLC-beta 1 Antibody [NBP2-38220] - Staining of human pancreas shows low expression as expected.
This antibody was developed against a recombinant protein corresponding to amino acids: NKKKSHKSSEGSGKKKLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVN
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLCB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Phospholipase C beta 1 is encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. This gene is activated by two G-protein alpha subunits, alpha-q and alpha-11. Two transcript variants encoding different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PLC-beta 1 Antibody - BSA Free and receive a gift card or discount.