![Western Blot: FMN1 Antibody [NBP3-35318] - Western blot analysis of various lysates using FMN1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp3-35318_rabbit-fmn1-pab-1012202411535878.jpg "Western Blot: FMN1 Antibody [NBP3-35318] - Western blot analysis of various lysates using FMN1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 1s.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit FMN1 Antibody - BSA Free (NBP3-35318) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-495 of human FMN1 (NP_001096654.1). Sequence: NIDMPKTEPKGADPESPRREEMGCNADQESQSGPGVPQTQGGEVKPKSPETALEAFKALFIRPPRKGTTADTSELEALKRKMRHEKESLRAVFERSNSKPADGPSDSKSPDHSLTEQDDRTPGRLQAVWPPPKTKDTEEKVGLKYT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FMN1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 158 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Immunocytochemistry TNF-alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_AF-410-NA_Immunocytochemistry_7296.jpg)
![Neutralization TNF-alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_AF-410-NA_Block_Neutralize_8706.jpg)
![Immunocytochemistry TNF-alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_AF-410-NA_Immunocytochemistry_9636.jpg)
Secondary Antibodies |
Isotype Controls |
|
FANCD2 and DNA damage repair Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t... Read full blog post. |
|
The affects of Perilipin 2 on diet and metabolism Perilipin 2 belongs to the Perilipin family, which consists of proteins that coat intracellular lipid storage droplets. Perilipin 2 in particular is involved in lipid globule surface membrane composition, and has also been implicated in the develo... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FMN1 |
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunocytochemistry IL-2 Antibody (5355) [Unconjugated]](https://images.novusbio.com/images2/IL-2_MAB602_Immunocytochemistry_6625.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")