Flotillin-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Flotillin-1 Antibody [NBP1-87498] -Analysis in human adrenal gland and skin tissues using NBP1-87498 antibody. Corresponding FLOT1 RNA-seq data are presented for the same tissues.

Western Blot: Flotillin-1 Antibody [NBP1-87498] - Analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Western Blot: Flotillin-1 Antibody [NBP1-87498] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Flotillin-1 Antibody [NBP1-87498] - Staining of human adrenal gland shows high expression.

Immunohistochemistry-Paraffin: Flotillin-1 Antibody [NBP1-87498] -Staining of human Adrenal gland shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Flotillin-1 Antibody [NBP1-87498] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Flotillin-1 Antibody [NBP1-87498] - Staining of human Stomach shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Flotillin-1 Antibody [NBP1-87498] -Staining of human Skin shows very weak membranous positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Flotillin-1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FLOT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID:32180897)
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Flotillin-1 Protein (NBP1-87498PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Flotillin-1 Antibody - BSA Free

• flotillin 1
• flotillin-1
• integral membrane component of caveolae

Background

Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Flotillin-1 Antibody (NBP1-87498)(2)

Publications using NBP1-87498

• Listik E, Toma L Glypican-1 in human glioblastoma: implications in tumorigenesis and chemotherapy Oncotarget 2020-03-03 [PMID: 32180897] (ICC/IF, Human)
• Walton JR, Frey HA, Vandre DD et al. Expression of flotillins in the human placenta: potential implications for placental transcytosis. Histochem Cell Biol 2013-03-01 [PMID: 23064789]

Bioinformatics

• Gene Symbol: FLOT1