FLJ21908 Antibody

Images

 
Western Blot: FLJ21908 Antibody [NBP1-89849] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: FLJ21908 Antibody [NBP1-89849] - Staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm and cytoskeleton (intermediate filaments).
Immunohistochemistry-Paraffin: FLJ21908 Antibody [NBP1-89849] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FLJ21908 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ERVLELEPNNFEATNELRKISQALASKENSYPKEADIVIKSTEGERKQIEAQQNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FLJ21908 Protein (NBP1-89849PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FLJ21908 Antibody

  • FLJ21908
  • RNA polymerase II associated protein 3
  • RNA polymerase II-associated protein 3
  • spag

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-92594
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-92269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
640-A3
Species: Mu
NBP1-80694
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-81761
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-14512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA

Publications for FLJ21908 Antibody (NBP1-89849) (0)

There are no publications for FLJ21908 Antibody (NBP1-89849).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ21908 Antibody (NBP1-89849) (0)

There are no reviews for FLJ21908 Antibody (NBP1-89849). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FLJ21908 Antibody (NBP1-89849) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLJ21908 Products

Bioinformatics Tool for FLJ21908 Antibody (NBP1-89849)

Discover related pathways, diseases and genes to FLJ21908 Antibody (NBP1-89849). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLJ21908 Antibody (NBP1-89849)

Discover more about diseases related to FLJ21908 Antibody (NBP1-89849).
 

Pathways for FLJ21908 Antibody (NBP1-89849)

View related products by pathway.

PTMs for FLJ21908 Antibody (NBP1-89849)

Learn more about PTMs related to FLJ21908 Antibody (NBP1-89849).

Blogs on FLJ21908

There are no specific blogs for FLJ21908, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLJ21908 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPAP3