Home » FLJ21908 » FLJ21908 Antibodies » FLJ21908 Antibody

FLJ21908 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: FLJ21908 Antibody [NBP1-89849] - Analysis using Anti-RPAP3 antibody NBP1-89849 (A) shows similar pattern to independent antibody NBP1-89850 (B).
Independent Antibodies: Western Blot: FLJ21908 Antibody [NBP1-89849] - Analysis using Anti-RPAP3 antibody NBP1-89849 (A) shows similar pattern to independent antibody NBP1-89850 (B).
Immunohistochemistry-Paraffin: FLJ21908 Antibody [NBP1-89849] - Staining of human testis.
Western Blot: FLJ21908 Antibody [NBP1-89849] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: FLJ21908 Antibody [NBP1-89849] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: FLJ21908 Antibody [NBP1-89849] - Staining of human cerebral cortex, colon, fallopian tube and testis using Anti-RPAP3 antibody NBP1-89849 (A) shows similar ...read more
Immunohistochemistry-Paraffin: FLJ21908 Antibody [NBP1-89849] - Staining of human fallopian tube.
Immunohistochemistry-Paraffin: FLJ21908 Antibody [NBP1-89849] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: FLJ21908 Antibody [NBP1-89849] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

        

Order Details

100% Guarantee on every product

FLJ21908 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ERVLELEPNNFEATNELRKISQALASKENSYPKEADIVIKSTEGERKQIEAQQNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANAL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FLJ21908 Protein (NBP1-89849PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FLJ21908 Antibody

  • FLJ21908
  • RNA polymerase II associated protein 3
  • RNA polymerase II-associated protein 3
  • spag

Background

FLJ21908, also known as RNA polymerase II associated protein, has a 665 amino acid isoform that is 76 kDa, a 631 amino acid isoform that is 72 kDa, and a 506 amino acid isoform that is 57 kDa; is involved in formation of an interface between the RNA polymerase II enzyme and chaperone/scaffolding protein, suggesting that it is required to connect RNA polymerase II to regulators of protein complex formation. Disease research suggests correlation of this protein with sickle cell trait and malaria. This protein has interactions with HSP90AA1, HSP90AB1, MAP3K3, ITCH, PPP1CA, POLR2A, HELLS, WDR92 and TEL02.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RUVBL2 Antibody
(OTI1A6)
NBP2-01764
Flow Cytometry: RUVBL2 Antibody (1A6) [NBP2-01764] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RUVBL2 antibody, and then analyzed by flow cytometry.
Western Blot: RUVBL2 Antibody (1A6) [NBP2-01764] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RUVBL2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RUVBL2.
Immunohistochemistry-Paraffin: RUVBL2 Antibody (1A6) [NBP2-01764] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-RUVBL2 mouse monoclonal antibody.
(1 Publication)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
WDR92 Antibody
NBP1-92594
Immunohistochemistry-Paraffin: WDR92 Antibody [NBP1-92594] - Staining of human stomach, upper shows strong cytoplasmic and nuclear positivity in glandular cells.
Western Blot: WDR92 Antibody [NBP1-92594] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: WDR92 Antibody [NBP1-92594] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
IKK gamma
Inhibitor Peptide Set
NBP2-26504
In vivo assay: IKK gamma Inhibitor Peptide Set [NBP2-26504] - NBD peptide blocks constitutive NF-kB as shown by EMSA. U266 cells were treated with 100 uM of control or NBD peptide for different time periods. Nuclear extracts were isolated and checked for NF-kB-DNA binding activity.
In vivo assay: IKK gamma Inhibitor Peptide Set [NBP2-26504] - NBD peptide blocks constitutive NF-kB activation in human multiple myeloma cells. U266 cells were treated with 100 uM of control (A & B) or NBD peptide (C & D) for 12 hr, cytospun, plated on glass slides, air dried for 1 hr at room temperature and fixed with cold acetone. Slides were blocked with 5% normal goat serum for 1 hr and then incubated with rabbit polyclonal anti-human p65 antibody (A & C) followed by Ig-Alexa 594 second step. In control peptide treated cells, p65 translocates to nucleus (A), whereas NBD peptide prevents translocation of p65 into the nucleus (C). B & D: Nuclear staining with DNA binding dye.
IKK gamma Inhibitor Peptide Set [NBP2-26504] - The IKK complex consists of IKKalpha + IKKbeta+ NEMO. NEMO (IKKgamma/NF-kB Essential MOdulator) is a scaffold protein required for the kinase activity of IKKalpha + IKKbeta. NBD (NEMO Binding Domain) inhibits formation of the IKK complex (IKKalpha + IKKbeta+ NEMO) by binding to NEMO and blocking IKK complex formation. In this regard, NBD is considered to be an 'IKKalpha and IKKBeta decoy' Blocking IKK complex formation suppresses downstream events in the NF-kB signaling pathway that rely on the IKK complex including phosphorylation of IkBalpha, and subsequence IkBalpha ubiquination, degradation and release of NF-kB. Hence, NF-kB is retained in the cytoplasm in its inactive state.
(22 Publications)
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
Histone H2AX [p
Ser139] Antibody [Unc ...
AF2288
Western blot shows lysates of Jurkat human acute T cell leukemia cell line untreated (-) or treated (+) with 1 μM camptothecin (CPT) for for the indicated times. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human Phospho-Histone H2AX (S139) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2288), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Histone H2AX (S139) at approximately 20 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line untreated (-) or treated (+) with 1 µM Camptothecin (CPT) for 24 hours, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Histone H2AX (S139) at approximately 25 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human Phospho-Histone H2AX (S139) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2288). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Histone H2AX phosphorylated at S139 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line treated with ultraviolet radiation using Rabbit Anti-Human Phospho-Histone H2AX (S139) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2288) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase‑3 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Rabbit Anti-Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Caspase‑3 was detected in immersion fixed Jurkat human acute T cell leukemia cell line stimulated with staurosporin using Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (yellow; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Reviews)
(200 Publications)
Species: Hu, Mu
Applications: ICC, IHC
PIH1D1 Antibody
NBP1-92269
Immunohistochemistry-Paraffin: PIH1D1 Antibody [NBP1-92269] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: PIH1D1 Antibody [NBP1-92269] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Western Blot: PIH1D1 Antibody [NBP1-92269] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
POLR1A Antibody
NBP2-32016
Immunohistochemistry-Paraffin: POLR1A Antibody [NBP2-32016] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: POLR1A Antibody [NBP2-32016] - Staining of human kidney shows strong nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: POLR1A Antibody [NBP2-32016] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu
Applications: IHC, IHC-P
EphA3
640-A3
EphA3
(6 Publications)
Species: Mu
Applications: Bind
ETV7 Antibody
NBP1-80694
Immunocytochemistry/Immunofluorescence: ETV7 Antibody [NBP1-80694] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Western Blot: ETV7 Antibody [NBP1-80694] - Analysis in human cell line HDLM-2.
Western Blot: ETV7 Antibody [NBP1-80694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Species: Hu
Applications: ICC/IF, WB
POLR2C Antibody
NBP1-80817
Immunohistochemistry: POLR2C Antibody [NBP1-80817] - Staining of human ovary shows nuclear positivity.
Immunocytochemistry/Immunofluorescence: POLR2C Antibody [NBP1-80817] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules.
Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human cerebral cortex, colon, kidney and testis using Anti-POLR2C antibody NBP1-80817 (A) shows similar protein distribution across tissues to independent antibody NBP1-80818 (B).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) - BSA Free [NBP2-13075] - A plaque load in neocortex and hippocampus in APP/PS1 mice exposed to differential housing. Representative 10x MOAB-2 staining in hippocampus of APP/PS1 mice for each housing group. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28584278/) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
(2 Reviews)
(49 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
AAAS Antibody (5A1)
H00008086-M02
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - Western Blot analysis of AAAS expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry-Paraffin: AAAS Antibody (5A1) [H00008086-M02] - Analysis of monoclonal antibody to AAAS on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in PC-12.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
TEL2 Antibody
NBP1-81761
Western Blot: TEL2 Antibody [NBP1-81761] - Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: TEL2 Antibody [NBP1-81761] - Staining of human urinary bladder shows cytoplasmic and nuclear positivity in urothelial cells.
Immunocytochemistry/Immunofluorescence: TEL2 Antibody [NBP1-81761] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear bodies & cytosol.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ATR Antibody (2B5)
NB100-308
Immunocytochemistry/Immunofluorescence: ATR Antibody (2B5) [NB100-308] - Analysis of HeLa, using antibody at 1:100 dilution.
Western Blot: ATR Antibody (2B5) [NB100-308] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody [2B5] diluted at 1:500.
Western Blot: ATR Antibody (2B5) [NB100-308] - Raji whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody diluted at 1:500.
(19 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
SMG1 Antibody (1A8)
H00023049-M02
Immunohistochemistry-Paraffin: SMG1 Antibody (1A8) [H00023049-M02] - Analysis of monoclonal antibody to SMG1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: SMG1 Antibody (1A8) [H00023049-M02] - SMG1 monoclonal antibody (M02), clone 1A8 Analysis of SMG1 expression in Hela S3 NE.
Sandwich ELISA: SMG1 Antibody (1A8) [H00023049-M02] - Detection limit for recombinant GST tagged SMG1 is approximately 1ng/ml as a capture antibody.
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Leptin/OB [HRP]
DLP00
(138 Publications)
Species: Hu
Applications: ELISA
RPAP1 Antibody
NBP2-14512
Immunocytochemistry/Immunofluorescence: RPAP1 Antibody [NBP2-14512] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RPAP1 Antibody [NBP2-14512] - Staining of human colon shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Rapamycin reduces mTOR phosphorylation induced by TII. Whole-cell lysates were prepared from astrocytes activated with TII for 2 h. 10 nM Rapamycin was added at the beginning of the experiment and equal amounts of protein were analyzed by western blot for phosphorylated mTOR kinase (p-mTOR) (upper gel) and consequently for beta-actin (lower gel). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-8-1), licensed under a CC-BY licence.
N/A: TOR/mTOR [p Ser2448] Antibody [NB600-607]
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
FLJ21908 Antibody
NBP1-89849
FLJ21908 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FLJ21908 Antibody (NBP1-89849) (0)

There are no publications for FLJ21908 Antibody (NBP1-89849).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ21908 Antibody (NBP1-89849) (0)

There are no reviews for FLJ21908 Antibody (NBP1-89849). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FLJ21908 Antibody (NBP1-89849) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLJ21908 Products

Bioinformatics Tool for FLJ21908 Antibody (NBP1-89849)

Discover related pathways, diseases and genes to FLJ21908 Antibody (NBP1-89849). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLJ21908 Antibody (NBP1-89849)

Discover more about diseases related to FLJ21908 Antibody (NBP1-89849).
 

Pathways for FLJ21908 Antibody (NBP1-89849)

View related products by pathway.

PTMs for FLJ21908 Antibody (NBP1-89849)

Learn more about PTMs related to FLJ21908 Antibody (NBP1-89849).

Blogs on FLJ21908

There are no specific blogs for FLJ21908, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLJ21908 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RPAP3