RPAP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RPAP1 Antibody [NBP2-14512] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RPAP1 Antibody [NBP2-14512] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HITAVLTKIIERDTSSVAVNLPVPSGVAFPAVFLRSRDTQGKSATSGKRS IFAQEIAARRIAEAKGPSVGEVVPNVGPPEGAVTCETPTPRNQGCQLPGS SHSFQGPNLVTGKGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPAP1 Protein (NBP2-14512PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPAP1 Antibody

  • RPAP1 RNA polymerase II associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009150-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46733
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PPS010
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
NBP2-20163
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89849
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC

Publications for RPAP1 Antibody (NBP2-14512) (0)

There are no publications for RPAP1 Antibody (NBP2-14512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPAP1 Antibody (NBP2-14512) (0)

There are no reviews for RPAP1 Antibody (NBP2-14512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPAP1 Antibody (NBP2-14512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPAP1 Products

RPAP1 NBP2-14512

Bioinformatics Tool for RPAP1 Antibody (NBP2-14512)

Discover related pathways, diseases and genes to RPAP1 Antibody (NBP2-14512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPAP1 Antibody (NBP2-14512)

Discover more about diseases related to RPAP1 Antibody (NBP2-14512).
 

Pathways for RPAP1 Antibody (NBP2-14512)

View related products by pathway.

Blogs on RPAP1

There are no specific blogs for RPAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPAP1