PIH1D1 Antibody

Images

 
Western Blot: PIH1D1 Antibody [NBP1-92269] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: ...read more
Immunocytochemistry/ Immunofluorescence: PIH1D1 Antibody [NBP1-92269] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PIH1D1 Antibody [NBP1-92269] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIH1D1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MANPKLLGLELSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIH1D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PIH1D1 Protein (NBP1-92269PEP)
Publications
Read Publication using NBP1-92269.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIH1D1 Antibody

  • NOP17FLJ20643
  • Nucleolar protein 17 homolog
  • PIH1 domain containing 1
  • PIH1 domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01764
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20245
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-82515
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89850
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-32732
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90013
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NBP1-80694
Species: Hu
Applications: WB, ICC/IF
NBP2-76844
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
AF3499
Species: Hu
Applications: WB
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, KD
NBP1-57138
Species: Hu
Applications: WB
NBP1-81761
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO
NBP1-81680
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-59139
Species: Hu
Applications: WB, IP
NBP1-92269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PIH1D1 Antibody (NBP1-92269)(1)

Reviews for PIH1D1 Antibody (NBP1-92269) (0)

There are no reviews for PIH1D1 Antibody (NBP1-92269). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIH1D1 Antibody (NBP1-92269) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PIH1D1 Products

Bioinformatics Tool for PIH1D1 Antibody (NBP1-92269)

Discover related pathways, diseases and genes to PIH1D1 Antibody (NBP1-92269). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PIH1D1 Antibody (NBP1-92269)

View related products by pathway.

PTMs for PIH1D1 Antibody (NBP1-92269)

Learn more about PTMs related to PIH1D1 Antibody (NBP1-92269).
 

Research Areas for PIH1D1 Antibody (NBP1-92269)

Find related products by research area.

Blogs on PIH1D1

There are no specific blogs for PIH1D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIH1D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIH1D1