FLJ10808 Antibody - BSA Free

Immunohistochemistry-Paraffin: FLJ10808 Antibody [NBP1-87911] - Staining of human testis shows distinct positivity in spermatids.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in human cell line RH-30.

Product Discontinued

FLJ10808 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHLSFLQNAAKLYATVYCIPFAEEDLSADALLNILSEVKIQEFKPSNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEAT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBA6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 118 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FLJ10808 Antibody - BSA Free

• E1-L2
• FLJ10808
• FLJ23367
• Monocyte protein 4
• MOP4
• MOP-4
• UBA6, ubiquitin-activating enzyme E1
• UBE1L2
• Ubiquitin-activating enzyme 6
• ubiquitin-activating enzyme E1-like 2
• Ubiquitin-activating enzyme E1-like protein 2
• ubiquitin-like modifier activating enzyme 6
• ubiquitin-like modifier-activating enzyme 6

Background

Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E1 enzyme that initiates the activation and conjugation of ubiquitin-like proteins (Jin et al., 2007 [PubMed 17597759]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBA6
• Entrez:
  • 55236(Human)
• Uniprot:
  • A0AVT1()