FLJ10808 Antibody

Images

 
Western Blot: FLJ10808 Antibody [NBP1-87911] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: FLJ10808 Antibody [NBP1-87911] - Immunofluorescent staining of human cell line U-251 MG shows no positivity.
Immunohistochemistry-Paraffin: FLJ10808 Antibody [NBP1-87911] - Staining of human testis shows distinct positivity in spermatids.
Western Blot: FLJ10808 Antibody [NBP1-87911] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-222

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FLJ10808 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LHLSFLQNAAKLYATVYCIPFAEEDLSADALLNILSEVKIQEFKPSNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
118 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
FLJ10808 Protein (NBP1-87911PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FLJ10808 Antibody

  • E1-L2
  • FLJ10808
  • FLJ23367
  • Monocyte protein 4
  • MOP4
  • MOP-4
  • UBA6, ubiquitin-activating enzyme E1
  • UBE1L2
  • Ubiquitin-activating enzyme 6
  • ubiquitin-activating enzyme E1-like 2
  • Ubiquitin-activating enzyme E1-like protein 2
  • ubiquitin-like modifier activating enzyme 6
  • ubiquitin-like modifier-activating enzyme 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8408
Species: Hu
Applications: WB
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-82785
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1137
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NB100-87021
Species: Hu
Applications: WB, IP, PLA
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-46270
Species: Hu
Applications: WB, IHC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-45243
Species: Hu, Mu
Applications: WB, IHC-P, PEP-ELISA
NBP1-87911
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FLJ10808 Antibody (NBP1-87911) (0)

There are no publications for FLJ10808 Antibody (NBP1-87911).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ10808 Antibody (NBP1-87911) (0)

There are no reviews for FLJ10808 Antibody (NBP1-87911). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FLJ10808 Antibody (NBP1-87911) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLJ10808 Products

Bioinformatics Tool for FLJ10808 Antibody (NBP1-87911)

Discover related pathways, diseases and genes to FLJ10808 Antibody (NBP1-87911). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLJ10808 Antibody (NBP1-87911)

Discover more about diseases related to FLJ10808 Antibody (NBP1-87911).
 

Pathways for FLJ10808 Antibody (NBP1-87911)

View related products by pathway.

PTMs for FLJ10808 Antibody (NBP1-87911)

Learn more about PTMs related to FLJ10808 Antibody (NBP1-87911).

Blogs on FLJ10808

There are no specific blogs for FLJ10808, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLJ10808 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBA6
Entrez
Uniprot