Flavin containing monooxygenase 4 Antibody

Images

 
Immunohistochemistry-Paraffin: Flavin containing monooxygenase 4 Antibody [NBP2-14020] Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Flavin containing monooxygenase 4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGLCKIPPSQKLMMEATEKEQLIKRGVFKDTSKDKFDYIAYMDDIAACIG TKPSIPLLFLKDPRLAWEV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FMO4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Flavin containing monooxygenase 4 Protein (NBP2-14020PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Flavin containing monooxygenase 4 Antibody

  • dimethylaniline monooxygenase [N-oxide-forming] 4
  • Dimethylaniline oxidase 4
  • EC 1.14.13.8
  • flavin containing monooxygenase 4
  • FMO 4
  • FMO2
  • Hepatic flavin-containing monooxygenase 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86412
Species: Hu
Applications: IHC, IHC-P
NBP1-33583
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62682
Species: Hu
Applications: WB
NBP2-14020
Species: Hu
Applications: IHC, IHC-P

Publications for Flavin containing monooxygenase 4 Antibody (NBP2-14020) (0)

There are no publications for Flavin containing monooxygenase 4 Antibody (NBP2-14020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flavin containing monooxygenase 4 Antibody (NBP2-14020) (0)

There are no reviews for Flavin containing monooxygenase 4 Antibody (NBP2-14020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Flavin containing monooxygenase 4 Antibody (NBP2-14020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Flavin containing monooxygenase 4 Products

Bioinformatics Tool for Flavin containing monooxygenase 4 Antibody (NBP2-14020)

Discover related pathways, diseases and genes to Flavin containing monooxygenase 4 Antibody (NBP2-14020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flavin containing monooxygenase 4 Antibody (NBP2-14020)

Discover more about diseases related to Flavin containing monooxygenase 4 Antibody (NBP2-14020).
 

Pathways for Flavin containing monooxygenase 4 Antibody (NBP2-14020)

View related products by pathway.

PTMs for Flavin containing monooxygenase 4 Antibody (NBP2-14020)

Learn more about PTMs related to Flavin containing monooxygenase 4 Antibody (NBP2-14020).

Blogs on Flavin containing monooxygenase 4

There are no specific blogs for Flavin containing monooxygenase 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Flavin containing monooxygenase 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FMO4