Flavin containing monooxygenase 4 Antibody


Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-69026] - Rat Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity RtSpecies Glossary
Applications WB

Order Details

Flavin containing monooxygenase 4 Antibody Summary

Synthetic peptides corresponding to Fmo4 (flavin containing monooxygenase 4) The peptide sequence was selected from the middle region of Fmo4. Peptide sequence PGIHKFKGQILHSQEYRIPDAFRGKRILVVGLGNTGGDVAVELSGIAAQV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Fmo4 and was validated on Western blot.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Flavin containing monooxygenase 4 Antibody

  • dimethylaniline monooxygenase [N-oxide-forming] 4
  • Dimethylaniline oxidase 4
  • EC
  • flavin containing monooxygenase 4
  • FMO 4
  • FMO2
  • Hepatic flavin-containing monooxygenase 4


This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Rt
Applications: WB

Publications for Flavin containing monooxygenase 4 Antibody (NBP1-69026) (0)

There are no publications for Flavin containing monooxygenase 4 Antibody (NBP1-69026).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flavin containing monooxygenase 4 Antibody (NBP1-69026) (0)

There are no reviews for Flavin containing monooxygenase 4 Antibody (NBP1-69026). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flavin containing monooxygenase 4 Antibody (NBP1-69026) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Flavin containing monooxygenase 4 Products

Bioinformatics Tool for Flavin containing monooxygenase 4 Antibody (NBP1-69026)

Discover related pathways, diseases and genes to Flavin containing monooxygenase 4 Antibody (NBP1-69026). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flavin containing monooxygenase 4 Antibody (NBP1-69026)

Discover more about diseases related to Flavin containing monooxygenase 4 Antibody (NBP1-69026).

Pathways for Flavin containing monooxygenase 4 Antibody (NBP1-69026)

View related products by pathway.

PTMs for Flavin containing monooxygenase 4 Antibody (NBP1-69026)

Learn more about PTMs related to Flavin containing monooxygenase 4 Antibody (NBP1-69026).

Blogs on Flavin containing monooxygenase 4

There are no specific blogs for Flavin containing monooxygenase 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Flavin containing monooxygenase 4 Antibody and receive a gift card or discount.


Gene Symbol FMO4