Flavin containing monooxygenase 4 Antibody

Images

 
Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-69026] - Rat Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Flavin containing monooxygenase 4 Antibody Summary

Immunogen
Synthetic peptides corresponding to Fmo4 (flavin containing monooxygenase 4) The peptide sequence was selected from the middle region of Fmo4. Peptide sequence PGIHKFKGQILHSQEYRIPDAFRGKRILVVGLGNTGGDVAVELSGIAAQV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FMO4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Fmo4 and was validated on Western blot.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Flavin containing monooxygenase 4 Antibody

  • dimethylaniline monooxygenase [N-oxide-forming] 4
  • Dimethylaniline oxidase 4
  • EC 1.14.13.8
  • flavin containing monooxygenase 4
  • FMO 4
  • FMO2
  • Hepatic flavin-containing monooxygenase 4

Background

This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86412
Species: Hu
Applications: IHC, IHC-P
NBP1-33583
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62682
Species: Hu
Applications: WB
NBP1-69026
Species: Rt
Applications: WB

Publications for Flavin containing monooxygenase 4 Antibody (NBP1-69026) (0)

There are no publications for Flavin containing monooxygenase 4 Antibody (NBP1-69026).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flavin containing monooxygenase 4 Antibody (NBP1-69026) (0)

There are no reviews for Flavin containing monooxygenase 4 Antibody (NBP1-69026). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flavin containing monooxygenase 4 Antibody (NBP1-69026) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Flavin containing monooxygenase 4 Products

Bioinformatics Tool for Flavin containing monooxygenase 4 Antibody (NBP1-69026)

Discover related pathways, diseases and genes to Flavin containing monooxygenase 4 Antibody (NBP1-69026). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flavin containing monooxygenase 4 Antibody (NBP1-69026)

Discover more about diseases related to Flavin containing monooxygenase 4 Antibody (NBP1-69026).
 

Pathways for Flavin containing monooxygenase 4 Antibody (NBP1-69026)

View related products by pathway.

PTMs for Flavin containing monooxygenase 4 Antibody (NBP1-69026)

Learn more about PTMs related to Flavin containing monooxygenase 4 Antibody (NBP1-69026).

Blogs on Flavin containing monooxygenase 4

There are no specific blogs for Flavin containing monooxygenase 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Flavin containing monooxygenase 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FMO4
Uniprot