Recombinant Human Ficolin-3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Ficolin-3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-288 of Human FCN3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FCN3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ficolin-3 Protein

  • Collagen/fibrinogen domain-containing lectin 3 p35
  • Collagen/fibrinogen domain-containing protein 3
  • FCNHficolin 3
  • ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
  • ficolin (collagen/fibrinogen domain-containing) 3 (Hakata antigen)
  • ficolin-3
  • HAKA1MGC22543
  • Hakata antigen
  • H-ficolin

Background

FCN3( AAH20731, 1 a.a. - 289 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2428
Species: Hu
Applications: WB
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84706
Species: Hu
Applications: WB, IHC, IHC-P
AF1724
Species: Hu
Applications: WB, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
H00000712-P01
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP

Publications for Ficolin-3 Recombinant Protein (H00008547-P01) (0)

There are no publications for Ficolin-3 Recombinant Protein (H00008547-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ficolin-3 Recombinant Protein (H00008547-P01) (0)

There are no reviews for Ficolin-3 Recombinant Protein (H00008547-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ficolin-3 Recombinant Protein (H00008547-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ficolin-3 Products

Bioinformatics Tool for Ficolin-3 Recombinant Protein (H00008547-P01)

Discover related pathways, diseases and genes to Ficolin-3 Recombinant Protein (H00008547-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ficolin-3 Recombinant Protein (H00008547-P01)

Discover more about diseases related to Ficolin-3 Recombinant Protein (H00008547-P01).
 

Pathways for Ficolin-3 Recombinant Protein (H00008547-P01)

View related products by pathway.

PTMs for Ficolin-3 Recombinant Protein (H00008547-P01)

Learn more about PTMs related to Ficolin-3 Recombinant Protein (H00008547-P01).

Blogs on Ficolin-3

There are no specific blogs for Ficolin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ficolin-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FCN3