Ficolin-1 Antibody (2B7)

Images

 
Western Blot: Ficolin-1 Antibody (2B7) [H00002219-M06] - Analysis of FCN1 expression in transfected 293T cell line by FCN1 monoclonal antibody (M06), clone 2B7. Lane 1: FCN1 transfected lysatE (35.1 KDa). Lane 2: ...read more
ELISA: Ficolin-1 Antibody (2B7) [H00002219-M06] - Detection limit for recombinant GST tagged FCN1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ficolin-1 Antibody (2B7) Summary

Immunogen
FCN1 (NP_001994 201 a.a. - 300 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESY
Specificity
FCN1 - ficolin (collagen/fibrinogen domain containing) 1 (2B7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FCN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ficolin-1 Antibody (2B7)

  • Collagen/fibrinogen domain-containing protein 1
  • FCN1
  • Fcna
  • FCNM
  • FCNMficolin-A
  • ficolin (collagen/fibrinogen domain containing) 1
  • ficolin (collagen/fibrinogen domain-containing) 1
  • Ficolin1
  • Ficolin-1
  • Ficolin-A
  • ficolin-alpha
  • M-ficolin

Background

The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1 encoded by FCN1 is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2428
Species: Hu
Applications: WB
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1724
Species: Hu
Applications: WB, IP
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00000712-P01
Species: Hu
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for Ficolin-1 Antibody (H00002219-M06) (0)

There are no publications for Ficolin-1 Antibody (H00002219-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ficolin-1 Antibody (H00002219-M06) (0)

There are no reviews for Ficolin-1 Antibody (H00002219-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ficolin-1 Antibody (H00002219-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ficolin-1 Products

Bioinformatics Tool for Ficolin-1 Antibody (H00002219-M06)

Discover related pathways, diseases and genes to Ficolin-1 Antibody (H00002219-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ficolin-1 Antibody (H00002219-M06)

Discover more about diseases related to Ficolin-1 Antibody (H00002219-M06).
 

Pathways for Ficolin-1 Antibody (H00002219-M06)

View related products by pathway.

PTMs for Ficolin-1 Antibody (H00002219-M06)

Learn more about PTMs related to Ficolin-1 Antibody (H00002219-M06).

Blogs on Ficolin-1

There are no specific blogs for Ficolin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ficolin-1 Antibody (2B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol FCN1
Entrez
Uniprot