| Description | Novus Biologicals Rabbit Fibronectin Antibody - BSA Free (NBP1-84468) is a polyclonal antibody validated for use in IHC and WB. Anti-Fibronectin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIG |
| Marker | Mesenchymal Cells Marker |
| Predicted Species | Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FN1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 26015410). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-84468 | Applications | Species |
|---|---|---|
| Kwon CH, Park HJ, Choi JH et al. Snail and serpinA1 promote tumor progression and predict prognosis in colorectal cancer. Oncotarget 2015-08-21 [PMID: 26015410] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Fibronectin Antibody (NBP1-84468)Find related products by research area.
|
|
Nickel induces migratory and invasive phenotype in human epithelial cells by epigenetically activating ZEB1 By Jamshed Arslan Pharm.D. Nickel (Ni) is a naturally abundant metallic element. It is a major component of stainless steel, coins, and many other items of daily use. Disturbingly, Ni exposure is associated with can... Read full blog post. |
|
Bad news for stomach cancer: BAMBI protein inhibits gastric carcinoma via TGF-beta/epithelial-mesenchymal transition signaling By Jamshed Arslan Pharm.D. Gastric carcinoma is the second leading cause of cancer-related deaths worldwide. One of the key features of gastric carcinoma is acidosis, which promotes growth and metastasis of gastric ... Read full blog post. |
|
Alpha-smooth muscle actin and the modulation of endothelial and epithelial cell biology Actin is essential for a wide range of cell functions, ranging from cell division and chromatin remodeling to vesicle trafficking and maintenance of cellular structure. In fact, mislocalization of actin to cell junctions during development leads t... Read full blog post. |
|
Epithelial-Mesenchymal Transition (EMT) Markers Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a... Read full blog post. |
|
Fibronectin: Organizing Cell Activity across the ECM Fibronectin is a glycoprotein found in the extracellular matrix (ECM) that binds to integrins and other components of the ECM such as collagen and fibrin. Under normal physiological conditions, fibronectin is an important factor in cell adhesion, grow... Read full blog post. |
|
Using the Laminin Antibody in Angiogenesis Research Laminin is one of a large number of proteins expressed on the basal laminar of the ECM (extracellular matrix). The laminin antibody database covers several proteins, which interact with integrins and other receptor proteins to support cellular differe... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FN1 |