Fibrillin 1 Recombinant Protein Antigen

Images

 
There are currently no images for Fibrillin 1 Recombinant Protein Antigen (NBP1-84723PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Fibrillin 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBN1.

Source: E. coli

Amino Acid Sequence: HCVSGMGMGRGNPEPPVSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FBN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84723.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fibrillin 1 Recombinant Protein Antigen

  • ACMICD
  • Asprosin
  • FBN
  • FBN1
  • fibrillin 1 (Marfan syndrome)
  • Fibrillin 1
  • fibrillin 15
  • fibrillin-1
  • GPHYSD2
  • MASS
  • MFS1
  • OCTD
  • SGS
  • SSKS
  • WMS
  • WMS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-88169
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
AF-241-NA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB388
Species: Hu
Applications: AP, WB
AF4977
Species: Mu
Applications: WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
7754-BH/CF
Species: Hu
Applications: BA
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NBP1-87959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-88115
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
NB100-2527
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-84723PEP
Species: Hu
Applications: AC

Publications for Fibrillin 1 Recombinant Protein Antigen (NBP1-84723PEP) (0)

There are no publications for Fibrillin 1 Recombinant Protein Antigen (NBP1-84723PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibrillin 1 Recombinant Protein Antigen (NBP1-84723PEP) (0)

There are no reviews for Fibrillin 1 Recombinant Protein Antigen (NBP1-84723PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fibrillin 1 Recombinant Protein Antigen (NBP1-84723PEP). (Showing 1 - 1 of 1 FAQ).

  1. Hi - I have been looking at the fibrillin1 antibodies on your website. You indicate that some may be suitable for canine tissue on your website. could you let me know which of the 10 antibodies is the most suitable for canine.
    • We have unfortuantely not tested any of our products in canine samples. If you would like to try one of our product with canine samples, you would qualify for our Innovator's Reward Program. In exchange for a review of our product in an untested application or species, we would issue you a credit voucher for the purchase price. If you would like us to check the homology of a certain product against the canine sequence, just contact our technical support department at technical@novusbio.com.

Additional Fibrillin 1 Products

Research Areas for Fibrillin 1 Recombinant Protein Antigen (NBP1-84723PEP)

Find related products by research area.

Blogs on Fibrillin 1

There are no specific blogs for Fibrillin 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fibrillin 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FBN1