Recombinant Human Fibrillin 1 GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2772-2871 of Human Fibrillin 1 Source: Wheat Germ (in vitro) Amino Acid Sequence: SNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
FBN1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Fibrillin 1 GST (N-Term) Protein
Background
FBN1 - fibrillin 1 (Marfan syndrome)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: AP, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01)(1)
Showing Publication 1 -
1 of 1.
Reviews for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01) (0)
There are no reviews for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01). (Showing 1 - 1 of 1 FAQ).
-
Hi - I have been looking at the fibrillin1 antibodies on your website. You indicate that some may be suitable for canine tissue on your website. could you let me know which of the 10 antibodies is the most suitable for canine.
- We have unfortuantely not tested any of our products in canine samples. If you would like to try one of our product with canine samples, you would qualify for our Innovator's Reward Program. In exchange for a review of our product in an untested application or species, we would issue you a credit voucher for the purchase price. If you would like us to check the homology of a certain product against the canine sequence, just contact our technical support department at technical@novusbio.com.
Additional Fibrillin 1 Products
Research Areas for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01)
Find related products by research area.
|
Blogs on Fibrillin 1