Recombinant Human Fibrillin 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Fibrillin 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human FBN1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBN1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00002200-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Fibrillin 1 Protein

  • FBN
  • fibrillin 1 (Marfan syndrome)
  • fibrillin 1
  • fibrillin 15
  • fibrillin-1
  • MASS
  • MFS1
  • OCTD
  • SGS
  • SSKS
  • WMS

Background

FBN1 - fibrillin 1 (Marfan syndrome)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF3025
Species: Hu
Applications: WB, ICC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB388
Species: Hu
Applications: WB, AP
MAB3095
Species: Hu
Applications: WB, IHC
AF4977
Species: Mu
Applications: WB
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF3850
Species: Hu
Applications: WB
NBP1-87959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00002200-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01)(1)

Reviews for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01) (0)

There are no reviews for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Hi - I have been looking at the fibrillin1 antibodies on your website. You indicate that some may be suitable for canine tissue on the front page http://www.novusbio.com/primary-antibodies/fibrillin-1. could you let me know which of the 10 antibodies is the most suitable for canine.
    • We have unfortuantely not tested any of our products in canine samples. If you would like to try one of our product with canine samples, you would qualify for our Innovator's Reward Program. In exchange for a review of our product in an untested application or species, we would issue you a credit voucher for the purchase price. If you would like us to check the homology of a certain product against the canine sequence, just contact our technical support department at technical@novusbio.com.

Additional Fibrillin 1 Products

Bioinformatics Tool for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01)

Discover related pathways, diseases and genes to Fibrillin 1 Partial Recombinant Protein (H00002200-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01)

Discover more about diseases related to Fibrillin 1 Partial Recombinant Protein (H00002200-Q01).
 

Pathways for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01)

View related products by pathway.

PTMs for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01)

Learn more about PTMs related to Fibrillin 1 Partial Recombinant Protein (H00002200-Q01).
 

Research Areas for Fibrillin 1 Partial Recombinant Protein (H00002200-Q01)

Find related products by research area.

Blogs on Fibrillin 1

There are no specific blogs for Fibrillin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Fibrillin 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBN1