FHOD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FHOD1 Antibody [NBP1-83900] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human cerebellum shows no cytoplasmic positivity in Purkinje cells as expected.
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FHOD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FHOD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature ( PMID 24062339).
Control Peptide
FHOD1 Protein (NBP1-83900PEP)
Publications
Read Publications using
NBP1-83900 in the following applications:

  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24086398)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FHOD1 Antibody

  • FH1/FH2 domain-containing protein 1
  • FHOS1
  • FHOSFormin homolog overexpressed in spleen 1
  • formin homology 2 domain containing 1
  • Formin homology 2 domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24724
Species: Ca, Eq, Hu, Mu, Pm, Rt, RM
Applications: WB
NBP2-24748
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-33431
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-231
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-94174
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-47496
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023002-M03
Species: Hu, Mu, Rt
Applications: ELISA, IP, PLA, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-85217
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4779
Species: Hu
Applications: IHC, WB
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
NBP2-24615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-80419
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC-P, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB

Publications for FHOD1 Antibody (NBP1-83900)(3)

Reviews for FHOD1 Antibody (NBP1-83900) (0)

There are no reviews for FHOD1 Antibody (NBP1-83900). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FHOD1 Antibody (NBP1-83900). (Showing 1 - 1 of 1 FAQs).

  1. I have purchased the anti FHOD1 antibody, catalog number NBP1-83900, Lot R11876, and I would like to know the concentration since it is not specified in the vial. Also it would be helpful if you can recommend cell lines for which IF detection of FHOD1 with this antibody is specially good.
    • The concentration for NBP1-83900 Lot R11876 is 0.05 mg/ml. In our lab, for immunofluorescent staining of human cells, this antibody was tested in A-431 cell line wherein it showed positivity in the cytoplasm. Besides A-431, FHOD1 is highly expressed in A-549, HEK 293, HeLa and U-2 OS; and you may consider any of these cell lines as a positive control.

Secondary Antibodies

 

Isotype Controls

Additional FHOD1 Products

Bioinformatics Tool for FHOD1 Antibody (NBP1-83900)

Discover related pathways, diseases and genes to FHOD1 Antibody (NBP1-83900). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHOD1 Antibody (NBP1-83900)

Discover more about diseases related to FHOD1 Antibody (NBP1-83900).
 

Pathways for FHOD1 Antibody (NBP1-83900)

View related products by pathway.

PTMs for FHOD1 Antibody (NBP1-83900)

Learn more about PTMs related to FHOD1 Antibody (NBP1-83900).
 

Research Areas for FHOD1 Antibody (NBP1-83900)

Find related products by research area.

Blogs on FHOD1.

CD19: An Undoubted Biomarker for B Cells
CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FHOD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FHOD1