GRID2IP Antibody

Images

 
Western Blot: GRID2IP Antibody [NBP1-94174] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG
Immunohistochemistry-Paraffin: GRID2IP Antibody [NBP1-94174] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRID2IP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SETSHMSVKRLRWEQVENSEGTIWGQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPVPGPEPFRKKEVVEILSHKKAYNTSILLAHLKLSPAELRQVLMSMEP
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRID2IP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GRID2IP Protein (NBP1-94174PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRID2IP Antibody

  • delphilin
  • glutamate receptor, ionotropic, delta 2 (Grid2) interacting protein
  • ionotropic, delta 2 (Grid2) interacting protein 1
  • ionotropic, delta 2-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24748
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-33431
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-24724
Species: Ca, Eq, Hu, Mu, Pm, Rt, RM
Applications: WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-47496
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83900
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00023002-M03
Species: Hu, Mu, Rt
Applications: ELISA, IP, PLA, WB
NB600-231
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-24615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85217
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80419
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC-P, WB
NBP2-67632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-84718
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-48542
Species: Hu
Applications: IHC, IHC-P, WB
H00025861-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-93579
Species: Hu
Applications: IHC, IHC-P
NBP1-87933
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-94174
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GRID2IP Antibody (NBP1-94174) (0)

There are no publications for GRID2IP Antibody (NBP1-94174).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRID2IP Antibody (NBP1-94174) (0)

There are no reviews for GRID2IP Antibody (NBP1-94174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRID2IP Antibody (NBP1-94174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRID2IP Products

Bioinformatics Tool for GRID2IP Antibody (NBP1-94174)

Discover related pathways, diseases and genes to GRID2IP Antibody (NBP1-94174). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRID2IP Antibody (NBP1-94174)

Discover more about diseases related to GRID2IP Antibody (NBP1-94174).
 

Pathways for GRID2IP Antibody (NBP1-94174)

View related products by pathway.

PTMs for GRID2IP Antibody (NBP1-94174)

Learn more about PTMs related to GRID2IP Antibody (NBP1-94174).

Blogs on GRID2IP

There are no specific blogs for GRID2IP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRID2IP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRID2IP