DAAM2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody [NBP2-47496] - ACM containing Wnt11-positive exosomes control CEP192, AURKB and PLK4 through DVL2. Model for DVL2 regulating recruitment of CEP192, AURKB and PLK4 ...read more
Immunohistochemistry-Paraffin: DAAM2 Antibody [NBP2-47496] - Staining of human placenta shows strong positivity in endothelial cells.
Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody [NBP2-47496] - Staining of human cell line HEK 293 shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DAAM2 Antibody [NBP2-47496] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: DAAM2 Antibody [NBP2-47496] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: DAAM2 Antibody [NBP2-47496] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
PLK4 and AURKB regulate cell motility through DAAMs. d, e MDA-MB-231 cells were stimulated with DMEM or ACM in the presence of DMSO or centrinone + AZD as indicated. Cells were stained for actin and (d) DAAM1, or (e) ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DAAM2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQVREPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DAAM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DAAM2 Protein (NBP2-47496PEP)
Publications
Read Publications using
NBP2-47496 in the following applications:

  • KD
    1 publication
  • MA
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DAAM2 Antibody

  • dishevelled associated activator of morphogenesis 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DAAM2 Antibody (NBP2-47496)(3)

Reviews for DAAM2 Antibody (NBP2-47496) (0)

There are no reviews for DAAM2 Antibody (NBP2-47496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DAAM2 Antibody (NBP2-47496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DAAM2 Products

Array NBP2-47496

Blogs on DAAM2.

Developmental regulator Daam2 promotes glial cell tumors by degrading Von Hippel-Lindau protein
By Jamshed Arslan Pharm.D. Glioblastoma is an aggressive type of cancer that forms from the star-shaped glial cells of the central nervous system, called astrocytes. Intriguingly, several genes linked to glioblasto...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAAM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DAAM2