DAAM2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DAAM2 Antibody [NBP2-47496] - ACM containing Wnt11-positive exosomes control CEP192, AURKB and PLK4 through DVL2. Model for DVL2 regulating recruitment of CEP192, AURKB and PLK4 to cell cortex in response to ACM stimulation. Image collected and cropped by CiteAb from the following publication (//static-content.springer.com/esm/art%3A10.1038%2Fs41467-019-10241-w/MediaObjects/41467_2019_10241_MOESM1_ESM.pdf), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: DAAM2 Antibody [NBP2-47496] - Staining of human placenta shows strong positivity in endothelial cells.

Immunocytochemistry/Immunofluorescence: DAAM2 Antibody [NBP2-47496] - Staining of human cell line HEK 293 shows localization to nucleus & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DAAM2 Antibody [NBP2-47496] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: DAAM2 Antibody [NBP2-47496] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DAAM2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DAAM2 Antibody - BSA Free (NBP2-47496) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DAAM2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQVREPS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DAAM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DAAM2 Protein (NBP2-47496PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DAAM2 Antibody - BSA Free

• dishevelled associated activator of morphogenesis 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DAAM2 Antibody (NBP2-47496)(3)

Publications using NBP2-47496

• Chen A, Liu Z, Wu Q, Li H Disheveled-associated activator of morphogenesis 2 promotes invasion of colorectal cancer by activating PAK1 and promoting MMP7 expression Genes & genomics 2021-05-11 [PMID: 33974241]
• Fang X, Zhang D, Zhao W et al. Dishevelled Associated Activator Of Morphogenesis (DAAM) Facilitates Invasion of Hepatocellular Carcinoma by Upregulating Hypoxia-Inducible Factor 1 alpha (HIF-1alpha) Expression Med. Sci. Monit. 2020-08-09 [PMID: 32772041] (MA, KD, WB)
• Luo Y, Barrios-Rodiles M, Gupta GD Atypical function of a centrosomal module in WNT signalling drives contextual cancer cell motility Nat Commun 2019-05-29 [PMID: 31142743] (Human)

Bioinformatics

• Gene Symbol: DAAM2