FHL1 Antibody


Immunohistochemistry-Paraffin: FHL1 Antibody [NBP1-88746] - Staining of human skin shows low expression as expected.
Immunohistochemistry: FHL1 Antibody [NBP1-88746] - Staining of human skeletal muscle shows strong cytoplasmic and nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: FHL1 Antibody [NBP1-88746] - Staining in human skeletal muscle and skin tissues using anti-FHL1 antibody. Corresponding FHL1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

FHL1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKIRRAPPLSNN
Specificity of human FHL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FHL1 Recombinant Protein Antigen (NBP1-88746PEP)
Read Publication using NBP1-88746.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%). Reactivity reported in scientific literature (PMID: 16524965)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FHL1 Antibody

  • bA535K18.1
  • FHL1
  • four and a half LIM domains 1
  • HLH1
  • HPLH1
  • KYOT
  • KYO-T
  • LIM protein SLIMMER
  • skeletal muscle LIM-protein1
  • SLIM1
  • SLIM1Isl-1 and Mec-3 domains 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Ba
Applications: WB, ELISA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for FHL1 Antibody (NBP1-88746)(1)

Reviews for FHL1 Antibody (NBP1-88746) (0)

There are no reviews for FHL1 Antibody (NBP1-88746). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FHL1 Antibody (NBP1-88746) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FHL1 Products

Bioinformatics Tool for FHL1 Antibody (NBP1-88746)

Discover related pathways, diseases and genes to FHL1 Antibody (NBP1-88746). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHL1 Antibody (NBP1-88746)

Discover more about diseases related to FHL1 Antibody (NBP1-88746).

Pathways for FHL1 Antibody (NBP1-88746)

View related products by pathway.

PTMs for FHL1 Antibody (NBP1-88746)

Learn more about PTMs related to FHL1 Antibody (NBP1-88746).

Research Areas for FHL1 Antibody (NBP1-88746)

Find related products by research area.

Blogs on FHL1

There are no specific blogs for FHL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FHL1 Antibody and receive a gift card or discount.


Gene Symbol FHL1