Complement Factor H-related 1/CFHR1/CFHL1 Antibody

Western Blot: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Staining of human cell line U-251 MG shows localization to vesicles.

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Staining of human testis shows moderate extracellular space positivity in Leydig cells.

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Staining of human cervix shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Staining of human kidney shows moderate extracellular space positivity in cells in tubules and glomeruli.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Complement Factor H-related 1/CFHR1/CFHL1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CFHR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Complement Factor H-related 1/CFHR1/CFHL1 Protein (NBP2-14474PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Complement Factor H-related 1/CFHR1/CFHL1 Antibody

• BTA
• CFHL1FHR-1
• CFHLCFHR1P
• CFHR1
• complement factor H-related 1 pseudogene
• Complement Factor Hrelated 1
• Complement Factor H-related 1
• complement factor H-related protein 1
• FHR1
• FHR1CFHL1P
• H factor (complement)-like 1
• H factor (complement)-like 2
• H factor-like protein 1
• H36-1
• H36-2
• H-factor-like 1
• HFL1H36
• HFL2
• MGC104329

Background

The CFHL1 gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonasaeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed thatTuf acts as a virulence fac

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CFHR1