FGFR2 Antibody - BSA Free

Immunohistochemistry-Paraffin: FGF R2 Antibody [NBP1-88670] - Staining of human prostate shows moderate membranous positivity in glandular cells and weak cytoplasmic staining of smooth muscle cells.

Immunohistochemistry-Paraffin: FGF R2 Antibody [NBP1-88670] - Staining of human Fallopian tube shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: FGF R2 Antibody [NBP1-88670] - Staining of human endometrium shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: FGF R2 Antibody [NBP1-88670] - Staining of human skeletal muscle shows low positivity as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FGFR2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMV
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGFR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FGFR2 Recombinant Protein Antigen (NBP1-88670PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25035393).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FGFR2 Antibody - BSA Free

• BBDS
• BEK
• BFR-1
• CD332 antigen
• CD332
• CEK3
• CFD1
• craniofacial dysostosis 1
• EC 2.7.10
• EC 2.7.10.1
• ECT1
• FGF R2
• FGFR2
• fibroblast growth factor receptor 2
• FLJ98662
• Jackson-Weiss syndrome
• JWS
• Keratinocyte growth factor receptorreceptor like 14
• KGFR
• KSAM
• K-sam
• soluble FGFR4 variant 4
• TK14
• TK25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FGFR2 Antibody (NBP1-88670)(1)

Publication using NBP1-88670

• Tchaicha JH, Akbay EA, Altabef A et al. Kinase domain activation of FGFR2 yields high-grade lung adenocarcinoma sensitive to a pan-FGFR inhibitor in a mouse model of NSCLC. Cancer Res 2014-09-01 [PMID: 25035393] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: FGFR2
• Entrez:
  • 2263(Human)
• Uniprot:
  • P21802()