Home » FGFR2 » FGFR2 Antibodies » FGFR2 Antibody

FGFR2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: FGF R2 Antibody [NBP1-88670] - Staining of human prostate shows moderate membranous positivity in glandular cells and weak cytoplasmic staining of smooth muscle cells.
Immunohistochemistry-Paraffin: FGF R2 Antibody [NBP1-88670] - Staining of human prostate shows moderate membranous positivity in glandular cells and weak cytoplasmic staining of smooth muscle cells.
Immunohistochemistry-Paraffin: FGF R2 Antibody [NBP1-88670] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Immunohistochemistry-Paraffin: FGF R2 Antibody [NBP1-88670] - Staining of human Fallopian tube shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: FGF R2 Antibody [NBP1-88670] - Staining of human endometrium shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: FGF R2 Antibody [NBP1-88670] - Staining of human skeletal muscle shows low positivity as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FGFR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMV
Specificity
Specificity of human, mouse FGF R2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGFR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
IHC reported in scientific literature (PMID: 25035393). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using
NBP1-88670 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25035393).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FGFR2 Antibody

  • BBDS
  • BEK
  • BFR-1
  • CD332 antigen
  • CD332
  • CEK3
  • CFD1
  • craniofacial dysostosis 1
  • EC 2.7.10
  • EC 2.7.10.1
  • ECT1
  • FGF R2
  • FGFR2
  • fibroblast growth factor receptor 2
  • FLJ98662
  • Jackson-Weiss syndrome
  • JWS
  • Keratinocyte growth factor receptorreceptor like 14
  • KGFR
  • KSAM
  • K-sam
  • soluble FGFR4 variant 4
  • TK14
  • TK25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FGF basic/FGF2
[Unconjugated]
233-FB
1 µg/lane of Recombinant Human FGF basic/FGF2 (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human FGF basic/FGF2 (146 aa) (Catalog # 233-FB) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 0.1-0.6 ng/mL.
(13 Reviews)
(314 Publications)
Species: Hu
FGFR1 Antibody
(M19B2)
NB600-1287
Western Blot: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis of MCF7 (A), HepG2 (B), NIH3T3 (C), and PC-12 (D) cell lysate using FGF R1 antibody at 2 ug/ml.
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis using the Alexa Fluor 488 (R) conjugate of NB600-1287. Staining of FGF R1 in HEK293 and HEK293 FGFR transfected cells using anti-FGF R1 antibody. (Red) Positive cells, (Green) Negative cells, (Blue) Negative cells + antibody, (Pink) Positive cells + antibody. Image from verified customer review.
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Intracellular flow cytometric staining of 1 x 10^6 HEK-293 cells using FGF R1 antibody (Dark Blue) and Isotype control (Orange). An antibody concentration of 1 ug/1x10^6 cells was used.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IP, CyTOF-ready
KGF/FGF-7
[Unconjugated]
251-KG
KGF/FGF-7 [Unconjugated]
(42 Publications)
Species: Hu
FGF acidic/FGF1
[Unconjugated]
232-FA
FGF acidic/FGF1 [Unconjugated]
(1 Review)
(17 Publications)
Species: Hu
FGFR3 Antibody
(JM110-33)
NBP2-66840
Western Blot: FGF R3 Antibody (JM110-33) [NBP2-66840] - Analysis of FGFR3 on different cells lysates using anti-FGFR3 antibody at 1/500 dilution. Positive control: Line 1: 293 Line 2: HepG2
Immunocytochemistry/Immunofluorescence: FGF R3 Antibody (JM110-33) [NBP2-66840] - Staining FGFR3 in SH-SY5Y cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: FGF R3 Antibody (JM110-33) [NBP2-66840] - Analysis of paraffin-embedded mouse testis tissue using anti-FGFR3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
FGF-10
[Unconjugated]
345-FG
1 μg/lane of Recombinant Human FGF-10 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 21 kDa.
Recombinant Human FGF-10 (Catalog # 345-FG) stimulates cell proliferation of the 4MBr‑5 rhesus monkey epithelial cell line. The ED50 for this effect is 20‑100 ng/mL.
(56 Publications)
Species: Hu
FGFR4 Antibody
[Unconjugated]
AF2265
Western blot shows lysates of mouse heart tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse FGF R4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2265) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for FGF R4 at approximately 89 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
FGF R4 was detected in immersion fixed frozen sections of mouse embryo (11.5 d.p.c.) using Goat Anti-Mouse FGF R4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2265) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cartilage. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Review)
(2 Publications)
Species: Mu
Applications: WB, IHC
Recombinant Human
FGF-13 Protein
NBP2-35009
SDS-Page: Human FGF-13 Protein [NBP2-35009]
(2 Publications)
Species: Hu
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
ERK2 Antibody
(SZ25-01)
NBP2-67360
Western Blot: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of ERK2 on different lysates using anti-ERK2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: PC-12
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of paraffin-embedded mouse stomach tissue using anti-ERK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
FGF-8
[Unconjugated]
423-F8/CF
Recombinant Human/Mouse FGF-8b (Catalog # 423-F8/CF) stimulates cell proliferation in the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 6.5-40 ng/mL in the presence of 1 μg/mL heparin.
1 μg/lane of Recombinant Human/Mouse FGF-8b was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
(42 Publications)
Species: Hu, Mu
EGFR Antibody
[Unconjugated]
AF231
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
A431 human epithelial carcinoma cell line was stained with Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Review)
(8 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
FGF-4
7460-F4/CF
FGF-4
(1 Publication)
Species: Hu
EGF [Unconjugated]
236-EG
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
(14 Reviews)
(392 Publications)
Species: Hu
FGF-9
[Unconjugated]
273-F9
FGF-9 [Unconjugated]
(26 Publications)
Species: Hu
Filaggrin Antibody
NBP1-87528
Immunocytochemistry/Immunofluorescence: Filaggrin Antibody [NBP1-87528] - Staining of human cell line HaCaT shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human liver.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human kidney shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
FGF-3 Antibody
(MSD1)
NB200-603
FGF-3 Antibody (MSD1)
(1 Review)
(1 Publication)
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
EphB2 Antibody
[Unconjugated]
AF467
COLO 205 human colorectal adenocarcinoma cell line was stained with Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467, filled histogram) or isotype control antibody (Catalog #AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
D3 mouse embryonic stem cell line was stained with Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467, filled histogram) or isotype control antibody (Catalog #AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
EphB2 was detected in immersion fixed paraffin-embedded sections of human esophageal squamous cell carcinoma using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in cancer cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(9 Reviews)
(27 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for FGFR2 Antibody (NBP1-88670)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for FGFR2 Antibody (NBP1-88670) (0)

There are no reviews for FGFR2 Antibody (NBP1-88670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FGFR2 Antibody (NBP1-88670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional FGFR2 Products

Bioinformatics Tool for FGFR2 Antibody (NBP1-88670)

Discover related pathways, diseases and genes to FGFR2 Antibody (NBP1-88670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGFR2 Antibody (NBP1-88670)

Discover more about diseases related to FGFR2 Antibody (NBP1-88670).
 

Pathways for FGFR2 Antibody (NBP1-88670)

View related products by pathway.

PTMs for FGFR2 Antibody (NBP1-88670)

Learn more about PTMs related to FGFR2 Antibody (NBP1-88670).
 

Research Areas for FGFR2 Antibody (NBP1-88670)

Find related products by research area.

Blogs on FGFR2

There are no specific blogs for FGFR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGFR2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FGFR2
Entrez
Uniprot