FGFBP2 Antibody - BSA Free

Western Blot: FGFBP2 Antibody [NBP1-81341] - Analysis in control (vector only transfected HEK293T lysate) and FGFBP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: FGFBP2 Antibody [NBP1-81341] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FGFBP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGFBP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FGFBP2 Protein (NBP1-81341PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FGFBP2 Antibody - BSA Free

• 37 kDa killer-specific secretory protein
• FGF-Binding Protein 2
• FGFBP2
• FGF-BP2
• FGFBP-2
• fibroblast growth factor binding protein 2
• fibroblast growth factor-binding protein 2
• HBP17RP
• HBp17-RP
• killer-specific secretory protein of 37 kDa
• KSP37
• KSP37HBp17-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGFBP2