DNA polymerase delta p50 Antibody

Images

 
Western Blot: DNA polymerase delta p50 Antibody [NBP1-90925] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: DNA polymerase delta p50 Antibody [NBP1-90925] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry: DNA polymerase delta p50 Antibody [NBP1-90925] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNA polymerase delta p50 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA polymerase delta p50 Protein (NBP1-90925PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNA polymerase delta p50 Antibody

  • delta 2, regulatory subunit (50kD)
  • polymerase (DNA directed), delta 2, regulatory subunit 50kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81341
Species: Hu
Applications: WB, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-01407
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-19939
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB600-935
Species: Bv
Applications: WB, ELISA, IP
AF3926
Species: Hu, Mu, Rt
Applications: WB
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for DNA polymerase delta p50 Antibody (NBP1-90925) (0)

There are no publications for DNA polymerase delta p50 Antibody (NBP1-90925).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA polymerase delta p50 Antibody (NBP1-90925) (0)

There are no reviews for DNA polymerase delta p50 Antibody (NBP1-90925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNA polymerase delta p50 Antibody (NBP1-90925) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA polymerase delta p50 Products

Bioinformatics Tool for DNA polymerase delta p50 Antibody (NBP1-90925)

Discover related pathways, diseases and genes to DNA polymerase delta p50 Antibody (NBP1-90925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA polymerase delta p50 Antibody (NBP1-90925)

Discover more about diseases related to DNA polymerase delta p50 Antibody (NBP1-90925).
 

Pathways for DNA polymerase delta p50 Antibody (NBP1-90925)

View related products by pathway.

PTMs for DNA polymerase delta p50 Antibody (NBP1-90925)

Learn more about PTMs related to DNA polymerase delta p50 Antibody (NBP1-90925).
 

Research Areas for DNA polymerase delta p50 Antibody (NBP1-90925)

Find related products by research area.

Blogs on DNA polymerase delta p50

There are no specific blogs for DNA polymerase delta p50, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA polymerase delta p50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLD2