Recombinant Human FGF basic/FGF2/bFGF Protein

Images

 

Product Details

Summary
Product Discontinued
View other related FGF basic/FGF2/bFGF Peptides and Proteins

Order Details


    • Catalog Number
      H00002247-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human FGF basic/FGF2/bFGF Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-100 of Human FGF2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FGF2

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FGF basic/FGF2/bFGF Protein

  • basic fibroblast growth factor bFGF
  • Basic fibroblast growth factor
  • bFGF
  • FGF basic
  • FGF2
  • FGF-2
  • FGFBprostatropin
  • fibroblast growth factor 2 (basic)
  • HBGF-2
  • heparin-binding growth factor 2
  • Prostatropin

Background

FGF2 - fibroblast growth factor 2 (basic)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
AF232
Species: Hu
Applications: IHC, Neut, Simple Western, WB
291-G1
Species: Hu
Applications: BA
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
H00002263-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
M6000B
Species: Mu
Applications: ELISA
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
294-HG
Species: Hu
Applications: BA
DBD00
Species: Hu
Applications: ELISA
251-KG
Species: Hu
Applications: BA
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
267-N3
Species: Hu
Applications: BA
256-GF
Species: Hu
Applications: BA
H00002247-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for FGF basic/FGF2/bFGF Partial Recombinant Protein (H00002247-Q01) (0)

There are no publications for FGF basic/FGF2/bFGF Partial Recombinant Protein (H00002247-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF basic/FGF2/bFGF Partial Recombinant Protein (H00002247-Q01) (0)

There are no reviews for FGF basic/FGF2/bFGF Partial Recombinant Protein (H00002247-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF basic/FGF2/bFGF Partial Recombinant Protein (H00002247-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?
    • Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits , but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

Additional FGF basic/FGF2/bFGF Products

Research Areas for FGF basic/FGF2/bFGF Partial Recombinant Protein (H00002247-Q01)

Find related products by research area.

Blogs on FGF basic/FGF2/bFGF

There are no specific blogs for FGF basic/FGF2/bFGF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FGF basic/FGF2/bFGF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF2