FERMT3/URP2 Antibody

Immunocytochemistry/Immunofluorescence: FERMT3/URP2 Antibody [NBP2-57110] - Staining of human cell line MCF7 shows localization to vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FERMT3/URP2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FERMT3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FERMT3/URP2 Recombinant Protein Antigen (NBP2-57110PEP)

Reactivity Notes

Mouse 84%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FERMT3/URP2 Antibody

• fermitin family member 3
• FERMT3
• KIND3
• KIND3fermitin family homolog 3 (Drosophila)
• Kindlin 3
• Kindlin-3
• MGC10966
• MIG-2
• MIG2B
• MIG2BURP2SF
• MIG2-like protein
• UNC-112 related protein 2
• UNC112C
• Unc-112-related protein 2
• URP2
• URP2fermitin family homolog 3
• URP2SF

Background

URP2 plays a central role in cell adhesion in hematopoietic cells. Acts by activating the integrin beta-1-3(ITGB1, ITGB2 and ITGB3). Required for integrin-mediated platelet adhesion and leukocyte adhesion to endothelialcells. Required for activation of integri

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FERMT3