Kindlin Antibody - BSA Free

Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.

Analysis in human cell lines RT-4 and SK-MEL-30 using Anti-FERMT1 antibody. Corresponding FERMT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kindlin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FERMT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Kindlin Protein (NBP1-89883PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kindlin Antibody - BSA Free

• C20orf42fermitin family homolog 1
• chromosome 20 open reading frame 42
• fermitin family homolog 1 (Drosophila)
• fermitin family member 1
• FLJ20116
• KIND1DTGCU2
• kindlerin
• kindlin 1
• Kindlin syndrome protein
• Kindlin-1
• UNC112 related protein 1
• UNC112A
• Unc-112-related protein 1
• URP1FLJ23423

Background

Due to a concerted effort to identify biomarkers for lung and colon carcinomas by genome-wide transcriptional profiling, the identification and cloning of one such gene as well as two additional closely related genes was achieved. Due to the strong sequence homology to the C. elegans UNC-112 a novel gene gene was named URP1, for UNC-112 related protein. Another novel related gene, URP2 and the previously discovered MIG-2 gene was also identified. Transcriptional analysis shows that only URP1 is significantly differentially regulated, being over-expressed in 70% of the colon carcinomas and 60% of the lung carcinomas tested. Quantification of URP1 expression by qRT-PCR showed up-regulation of the gene by 60-fold in lung tumors and up to nearly 6-fold in colon tumors. Northern blot analysis of URP1 indicates that normal expression is restricted to neuromuscular tissues. In contrast, the expression of URP2 appears to be confined primarily to tissues of the immune system. URP1 has the potential to be one of the most important prognostic and diagnostic markers of colon or lung cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FERMT1