FCRN/FCGRT Antibody - BSA Free

Western Blot: FCRN/FCGRT Antibody [NBP1-59061] - Analysis of FCGRT expressed in HepG2 cells. Suggested titration: 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-59061] - Formalin Fixed Paraffin; Embedded Tissue: Human Lung Tissue; Observed Staining: Membrane and cytoplasmic in alveolar type I cells; Primary Antibody Concentration: 1:100

Western Blot: FCRN/FCGRT Antibody [NBP1-59061] - Analysis in Human 293T cells at 1ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FCRN/FCGRT Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FCGRT(Fc fragment of IgG, receptor, transporter, alpha) The peptide sequence was selected from the N terminal of FCGRT (NP_004098). Peptide sequence GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCGRT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FCRN/FCGRT Antibody - BSA Free

• alpha-chain
• Fc fragment of IgG, receptor, transporter, alpha
• FCGRT
• FcRn alpha chain
• FCRN
• FCRNimmunoglobulin receptor, intestinal, heavy chain
• IgG Fc fragment receptor transporter alpha chain
• IgG receptor FcRn large subunit p51
• major histocompatibility complex class I-like Fc receptor
• Neonatal Fc receptor
• neonatal Fc-receptor for Ig

Background

FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FCGRT
• Entrez:
  • 2217(Human)
  • 14132(Mouse)
• Uniprot:
  • P55899()