FCRL3/FcRH3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit FCRL3/FcRH3 Antibody - BSA Free (NBP2-62615) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: AQGDTYWYHDEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKPLNIQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FCRL3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FCRL3/FcRH3 Antibody - BSA Free
Background
The FCRL3 gene codes for a member of the immunoglobulin receptor superfamily, a Fc receptor-like protein 3 that has seven isoforms: isoform 1: 734 amino acids long, 80 kDA; isoform 2: 639 amino acids long, nearly 70 kDA; isoform 3: 740 amino acids long, 81 kDA; isoform 4: 189 amino acids long, 21 kDA; isoform 5: 199 amino acids long, 22 kDA; isoform 6: 742 amino acid long, 81 kDA; and isoform 7: 707 amino acids long, 77 kDA. This protein functions in the moderation of the immune system as it obtains immunoreceptor-tyrosine activation motifs as well as immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain. It is known to interact with genes SYK, PTPN6, ZAP70, and PTPN11. FCRL3 is linked to multiple sclerosis, graves' disease, arthritis, lupus, rheumatoid arthritis, alopecia areata, behcet's disease, and primary biliary cirrhosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: WB
Publications for FCRL3/FcRH3 Antibody (NBP2-62615) (0)
There are no publications for FCRL3/FcRH3 Antibody (NBP2-62615).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FCRL3/FcRH3 Antibody (NBP2-62615) (0)
There are no reviews for FCRL3/FcRH3 Antibody (NBP2-62615).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FCRL3/FcRH3 Antibody (NBP2-62615) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FCRL3/FcRH3 Products
Blogs on FCRL3/FcRH3