FCGBP Antibody - BSA Free

Immunohistochemistry-Paraffin: FCGBP Antibody [NBP1-90462] - Analysis in human small intestine and liver tissues using NBP1-90462 antibody. Corresponding FCGBP RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FCGBP Antibody [NBP1-90462] - Staining of human kidney, liver, small intestine and testis using Anti-FCGBP antibody NBP1-90462 (A) shows similar protein distribution across tissues to independent antibody NBP1-90461 (B).

Immunohistochemistry-Paraffin: FCGBP Antibody [NBP1-90462] - Staining of human small intestine shows strong positivity in mucus in goblet cells.

Immunohistochemistry-Paraffin: FCGBP Antibody [NBP1-90462] - Staining of human kidney shows low positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: FCGBP Antibody [NBP1-90462] - Staining of human testis shows low positivity in cells in seminiferous ducts as expected.

Immunohistochemistry-Paraffin: FCGBP Antibody [NBP1-90462] - Staining of human liver shows low positivity in hepatocytes as expected.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FCGBP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GHRFDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHRGSQAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVALPFQLDSLLHAHLSGADVVVTTTSGLSLAFDGDSF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCGBP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reactivity reported in scientific literature (PMID: 26162072).
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FCGBP Protein (NBP1-90462PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%). Mouse reactivity reported in scientific literature (PMID: 26162072).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FCGBP Antibody - BSA Free

• Fc fragment of IgG binding protein
• FC(GAMMA)BP
• fcgamma-binding protein antigen
• fcgammaBP
• Human Fc gamma BP
• IgG Fc binding protein
• IgGFc-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FCGBP Antibody (NBP1-90462)(3)

Publications using NBP1-90462

• HAglin S, Bohm S, Berghard A Single or Repeated Ablation of Mouse Olfactory Epithelium by Methimazole BIO-PROTOCOL 2021-04-20 [PMID: 34124287]
• Haglin S, Berghard A, Bohm S Increased Retinoic Acid Catabolism in Olfactory Sensory Neurons Activates Dormant Tissue-Specific Stem Cells and Accelerates Age-Related Metaplasia J. Neurosci. 2020-05-20 [PMID: 32385093] (IHC-F, Mouse)
• Erickson NA, Nystrom EE, Mundhenk L et al. The Goblet Cell Protein Clca1 (Alias mClca3 or Gob-5) Is Not Required for Intestinal Mucus Synthesis, Structure and Barrier Function in Naive or DSS-Challenged Mice. PLoS One 2015-01-01 [PMID: 26162072] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: FCGBP