Claudin-8 Antibody

Images

 
Western Blot: Claudin-8 Antibody [NBP1-59157] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Claudin-8 Antibody [NBP1-59157] - Human Intestine
Western Blot: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - HepG2 cell lysate, Antibody Titration: 0.5-1.0ug/ml
Immunohistochemistry-Paraffin: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with ...read more

Product Details

Summary
Reactivity Hu, PoSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Claudin-8 Antibody Summary

Immunogen
Synthetic peptides corresponding to CLDN8 (claudin 8) The peptide sequence was selected from the C terminal of CLDN8. Peptide sequence IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLDN8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CLDN8 and was validated on Western Blot and immunohistochemistry-paraffin
Publications
Read Publications using
NBP1-59157 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Porcine reported in scientific literature (PMID: 35336858).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Claudin-8 Antibody

  • claudin 8
  • Claudin8
  • Claudin-8
  • CLDN8
  • human CLDN8 gene for claudin-810claudin-8

Background

CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB4620
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-02259
Species: Hu, Mu, Po, Rt
Applications: Flow, ICC/IF
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
MAB3656
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NBP2-47940
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB4284
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00024146-D01P
Species: Hu
Applications: WB
MAB4279
Species: Hu
Applications: CyTOF-ready, Flow
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for Claudin-8 Antibody (NBP1-59157)(2)

We have publications tested in 1 confirmed species: Porcine.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Porcine
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-59157 Applications Species
Wu RL, Vazquez-Roque MI, Carlson P et al. Gluten-induced symptoms in diarrhea-predominant irritable bowel syndrome are associated with increased myosin light chain kinase activity and claudin-15 expression. Lab. Invest. Nov 21 2016 [PMID: 27869798]
Sun W, Wu W, Jiang N et al. Highly Pathogenic PRRSV-Infected Alveolar Macrophages Impair the Function of Pulmonary Microvascular Endothelial Cells Viruses Feb 22 2022 (WB, Porcine) WB Porcine

Reviews for Claudin-8 Antibody (NBP1-59157) (0)

There are no reviews for Claudin-8 Antibody (NBP1-59157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-8 Antibody (NBP1-59157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Claudin-8 Products

Bioinformatics Tool for Claudin-8 Antibody (NBP1-59157)

Discover related pathways, diseases and genes to Claudin-8 Antibody (NBP1-59157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-8 Antibody (NBP1-59157)

Discover more about diseases related to Claudin-8 Antibody (NBP1-59157).
 

Pathways for Claudin-8 Antibody (NBP1-59157)

View related products by pathway.

Blogs on Claudin-8

There are no specific blogs for Claudin-8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Claudin-8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN8
Uniprot