FCGBP Antibody

Images

 
Immunohistochemistry-Paraffin: FCGBP Antibody [NBP1-90461] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FCGBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQAGDVVEFEVRPSWPLYLSANVGIQVLLFGTGAIRNEVTYDPYLVLIPDVAAYCPAYVVKSVPGCEGVALVVAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSYAEVELGTADMIHTAEATTNLGLLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCGBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FCGBP Protein (NBP1-90461PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FCGBP Antibody

  • Fc fragment of IgG binding protein
  • FC(GAMMA)BP
  • fcgamma-binding protein antigen
  • fcgammaBP
  • Human Fc gamma BP
  • IgG Fc binding protein
  • IgGFc-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52932
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB5275
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89128
Species: Hu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB110-68135
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB200-204
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-90461
Species: Hu
Applications: IHC, IHC-P

Publications for FCGBP Antibody (NBP1-90461) (0)

There are no publications for FCGBP Antibody (NBP1-90461).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCGBP Antibody (NBP1-90461) (0)

There are no reviews for FCGBP Antibody (NBP1-90461). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FCGBP Antibody (NBP1-90461) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCGBP Products

FCGBP NBP1-90461

Bioinformatics Tool for FCGBP Antibody (NBP1-90461)

Discover related pathways, diseases and genes to FCGBP Antibody (NBP1-90461). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCGBP Antibody (NBP1-90461)

Discover more about diseases related to FCGBP Antibody (NBP1-90461).
 

Pathways for FCGBP Antibody (NBP1-90461)

View related products by pathway.

PTMs for FCGBP Antibody (NBP1-90461)

Learn more about PTMs related to FCGBP Antibody (NBP1-90461).

Blogs on FCGBP

There are no specific blogs for FCGBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FCGBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCGBP