FBXW5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FBXW5 Antibody [NBP1-91892] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FBXW5 Antibody [NBP1-91892] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FBXW5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FBXW5 Antibody - BSA Free (NBP1-91892) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PDNRYLYVNSRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLARLRHEDVVNSVVFSPQEQ
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXW5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FBXW5 Protein (NBP1-91892PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FBXW5 Antibody - BSA Free

• DKFZp434B205
• F-box and WD repeat domain containing 5
• F-box and WD-40 domain protein 5
• F-box and WD-40 domain-containing protein 5
• F-box/WD repeat-containing protein 5
• Fbw5
• MGC20962
• RP11-229P13.10
• WD repeat-containing F-box protein FBW5

Background

The FBXW5 gene encodes a F-box/WD repeat-containing protein 5 that exists in two isoforms. Isoform 1 is 556 amino acids long, at nearly 64 kDA while isoform 2 is 377 amino acids long at 42 kDA. This protein encoded by this gene functions in substrate recognition of SCF as well as DCX E3 ubiquitin-protein ligase complexes. It may also work as a negative regulator of MAP3K7/TAK1 signaling in the interleukin-1B signaling pathway. FBXW5 participates in protein chaperonin-mediated protein folding and metabolism as well as the association of TriC/CCT with target proteins during biosynthesis. It is known to interact with genes CUL1, MDFI, SKP1, KRTAP4-12, and UBE2R2. FBXW5 is associated with tuberous sclerosis as well as hepatitis b.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXW5