New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Recombinant Human FBXO3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FBXO3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 131-229 of Human FBXO3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQM

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXO3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXO3 GST (N-Term) Protein

  • DKFZp564B092
  • F-box protein 3
  • F-box protein FBX3
  • FBX3FBAF-box only protein 3

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4779
Species: Hu
Applications: IHC, WB
NBP1-87441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-89985
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00027109-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-84721
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-84720
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16542
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
MAB5646
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, KO, WB
AF5697
Species: Hu
Applications: ICC, WB
255-SC/CF
Species: Hu
Applications: BA
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP2-70739
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP2-67147
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-14474
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2564
Species: Hu
Applications: WB
DFS00
Species: Hu
Applications: ELISA
H00026273-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for FBXO3 Partial Recombinant Protein (H00026273-Q01) (0)

There are no publications for FBXO3 Partial Recombinant Protein (H00026273-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO3 Partial Recombinant Protein (H00026273-Q01) (0)

There are no reviews for FBXO3 Partial Recombinant Protein (H00026273-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXO3 Partial Recombinant Protein (H00026273-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXO3 Products

Bioinformatics Tool for FBXO3 Partial Recombinant Protein (H00026273-Q01)

Discover related pathways, diseases and genes to FBXO3 Partial Recombinant Protein (H00026273-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO3 Partial Recombinant Protein (H00026273-Q01)

Discover more about diseases related to FBXO3 Partial Recombinant Protein (H00026273-Q01).

PTMs for FBXO3 Partial Recombinant Protein (H00026273-Q01)

Learn more about PTMs related to FBXO3 Partial Recombinant Protein (H00026273-Q01).
 

Research Areas for FBXO3 Partial Recombinant Protein (H00026273-Q01)

Find related products by research area.

Blogs on FBXO3

There are no specific blogs for FBXO3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXO3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO3