FBRS Antibody

Images

 
Western Blot: FBRS Antibody [NBP1-83917] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: FBRS Antibody [NBP1-83917] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FBRS Antibody [NBP1-83917] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: FBRS Antibody [NBP1-83917] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBRS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBRS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBRS Protein (NBP1-83917PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-83917 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBRS Antibody

  • FBS
  • FBS1
  • fibrogenic lymphokine
  • fibrosin 1
  • fibrosin
  • FLJ11618
  • probable fibrosin-1 long transcript protein
  • probable fibrosin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-83917
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FBRS Antibody (NBP1-83917) (0)

There are no publications for FBRS Antibody (NBP1-83917).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for FBRS Antibody (NBP1-83917) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-83917:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot FBRS NBP1-83917
Enlarge
reviewed by:
Anonymous
WB Human 06/06/2015
View

Summary

ApplicationWestern Blot
Sample TestedHela whole cell lysate
SpeciesHuman
LotR40759

Blocking

Blocking DetailsBlocker=Skimmed milk, Buffer= 1XTris Buffer Saline+0.1 % Tween 20, 2hrs at RT

Primary Anitbody

Dilution Ratio1:500 over night at 4 degree Celsius

Secondary Antibody

Secondary Manufacturer Cat#7074P2
Secondary Concentration1:20,000

Details

Detection Notes90 seconds exposure

Comments

CommentsI would suggest to keep the blotted-membrane exposed to the x-ray film for longer. The FBRS protien band appears but with a major band of ~90 kDa. However, worked for me at least.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FBRS Antibody (NBP1-83917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBRS Products

FBRS NBP1-83917

Bioinformatics Tool for FBRS Antibody (NBP1-83917)

Discover related pathways, diseases and genes to FBRS Antibody (NBP1-83917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBRS Antibody (NBP1-83917)

Discover more about diseases related to FBRS Antibody (NBP1-83917).
 

Pathways for FBRS Antibody (NBP1-83917)

View related products by pathway.

Blogs on FBRS

There are no specific blogs for FBRS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
06/06/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol FBRS