Reactivity | HuSpecies Glossary |
Applications | WB, ICC/IF |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen | FANCF (NP_073562.1, 1 a.a. - 374 a.a.) full-length human protein. MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRRSAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALLQPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFRKRQVLGLSAGLSSV |
Specificity | This product is specific for Human FANCF purified MaxPab mouse polyclonal antibody (B01P) [Gene ID: 2188]. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | FANCF |
Purity | Protein G purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein G purified |
Publication using H00002188-B01P | Applications | Species |
---|---|---|
Wilson R, Espinosa-Diez C, Kanner N et al. MicroRNA regulation of endothelial TREX1 reprograms the tumour microenvironment. Nat Commun 2016-11-25 [PMID: 27886180] |
Secondary Antibodies |
Isotype Controls |
Fanconi Antibodies and Cancer Research We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | FANCF |
Uniprot |
|