| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit FANCD2 Antibody - BSA Free (NBP2-57171) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This FANCD2 Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FANCD2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 164.1 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for FANCD2 Antibody (NBP2-57171)Find related products by research area.
|
|
Sample collection from mammalian culture cells for kinomic analysis By Jamshed Arslan Pharm.D., PhD.IntroductionKinome describes kinases, and kinomics refers to the kinase signaling. Studying the effects of reagent (exogenously applied growth factor or inhibitor) on kinase activit... Read full blog post. |
|
FANCD2 and DNA damage repair Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t... Read full blog post. |
|
FANCD2 (Fanconi anemia subunit D2 protein) Fanconi anemia (FANC) is a rare, autosomal-recessive genetic disorder that is a heterogeneous cancer susceptibility condition that manifests with a wide range of symptoms such as congenital malformations, deteriorating bone marrow failure, DNA-dama... Read full blog post. |
|
FANCD2: A big component of the DNA repair crew The genetic disorder known as Fanconi anemia (FANC) is a heterogeneous, autosomal-recessive cancer susceptibility condition characterized by a wide array of symptoms. These include congenital malformations, progressive bone marrow failure, DNA-damage ... Read full blog post. |
|
FANCD2: DNA Repair and Beyond Fanconi anemia (FANC) is a heterogenous, autosomal-recessive cancer susceptibility genetic disorder that is characterized by a wide array of symptoms, including congenital defects, progressive bone marrow failure due to DNA-damage hypersensitivity, ch... Read full blog post. |
|
NUP153 & 53BP1: A Novel DNA Repair Pathway Mediating DNA damage is a crucial process, and one of the most important cellular guards against cancer. In response to DNA damage, sophisticated cellular machinery is recruited to repair the breaks, and if it fails, the cell is committed to death. De... Read full blog post. |
|
Fanconi Antibodies and Cancer Research We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FANCD2 |