FANCD2 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: FANCD2 Antibody [NBP2-57171] - Staining of human cell line SiHa using FANCD2 Antibody shows localization to nucleus, nuclear bodies & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

FANCD2 Antibody - BSA Free Summary

Immunogen
This FANCD2 Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FANCD2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
164.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
FANCD2 Recombinant Protein Antigen (NBP2-57171PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FANCD2 Antibody - BSA Free

  • DKFZp762A223
  • FA4
  • FACD
  • FAD
  • FAD2
  • FA-D2
  • FADFAD2
  • FANCD
  • FANCD2
  • Fanconi anemia complementation group D2
  • Fanconi anemia group D2 protein
  • Fanconi anemia, complementation group D2
  • FLJ23826
  • FPN1
  • HFE4
  • IREG1
  • Protein FACD2
  • SLC11A3

Background

Fanconi Anemia (FA) is an autosomal-recessive cancer-prone disorder characterized by congenital defects, progressive bone marrow failure, increased chromosomal breakage, defective DNA repair and cellular hypersensitivity to mitomycin C. Fanconi Anemia Complementation Group D (FANCD) is comprised of two separate proteins, FANCD1/BRCA2 and FANCD2. LYRIC/MTDH, an RNA binding protein, regulates expression of FANCD2 and FANCD1 (1). FANCD2 is mapped to chromosome 3p25.3, has a theoretical molecular weight of 166 kDa and is localized in the nucleus. FANCD2 is involved in the regulation of DNA-binding transcription factor activity and DNA stability through accurate and efficient pairing of homologs during meiosis to promote repair of double-strand DNA breaks (2). Ubiquitination is required for FANCD2 to bind to chromatin. In response to DNA damage, FANCD2 is monoubiquinated to result in colocalization with other proteins (BRCA1 and BRCA2) involved in homology-directed DNA repair in the nucleus and is deubiquitinated upon DNA repair completion.

References

1. Bi, J., Areecheewakul, S., Li, Y., Yang, S., Zhang, Y., Ebeid, K., . . . Meng, X. (2019). MTDH/AEG-1 downregulation using pristimerin-loaded nanoparticles inhibits Fanconi anemia proteins and increases sensitivity to platinum-based chemotherapy. Gynecol Oncol, 155(2), 349-358. doi:10.1016/j.ygyno.2019.08.014

2. Balcerek, J., Jiang, J., Li, Y., Jiang, Q., Holdreith, N., Singh, B., . . . Tong, W. (2018). Lnk/Sh2b3 deficiency restores hematopoietic stem cell function and genome integrity in Fancd2 deficient Fanconi anemia. Nat Commun, 9(1), 3915. doi:10.1038/s41467-018-06380-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-84305
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-16735
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-2564
Species: Hu
Applications: WB
MAB2476
Species: Hu
Applications: IHC, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-39681
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC,  IHC-P, IP, WB
664-LI
Species: Hu
Applications: BA
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB

Publications for FANCD2 Antibody (NBP2-57171) (0)

There are no publications for FANCD2 Antibody (NBP2-57171).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCD2 Antibody (NBP2-57171) (0)

There are no reviews for FANCD2 Antibody (NBP2-57171). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FANCD2 Antibody (NBP2-57171) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FANCD2 Products

Research Areas for FANCD2 Antibody (NBP2-57171)

Find related products by research area.

Blogs on FANCD2.

Sample collection from mammalian culture cells for kinomic analysis
By Jamshed Arslan Pharm.D., PhD.IntroductionKinome describes kinases, and kinomics refers to the kinase signaling. Studying the effects of reagent (exogenously applied growth factor or inhibitor) on kinase activit...  Read full blog post.

FANCD2 and DNA damage repair
Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t...  Read full blog post.

FANCD2 (Fanconi anemia subunit D2 protein)
Fanconi anemia (FANC) is a rare, autosomal-recessive genetic disorder that is a heterogeneous cancer susceptibility condition that manifests with a wide range of symptoms such as congenital malformations, deteriorating bone marrow failure, DNA-dama...  Read full blog post.

FANCD2: A big component of the DNA repair crew
The genetic disorder known as Fanconi anemia (FANC) is a heterogeneous, autosomal-recessive cancer susceptibility condition characterized by a wide array of symptoms. These include congenital malformations, progressive bone marrow failure, DNA-damage ...  Read full blog post.

FANCD2: DNA Repair and Beyond
Fanconi anemia (FANC) is a heterogenous, autosomal-recessive cancer susceptibility genetic disorder that is characterized by a wide array of symptoms, including congenital defects, progressive bone marrow failure due to DNA-damage hypersensitivity, ch...  Read full blog post.

NUP153 & 53BP1: A Novel DNA Repair Pathway
Mediating DNA damage is a crucial process, and one of the most important cellular guards against cancer. In response to DNA damage, sophisticated cellular machinery is recruited to repair the breaks, and if it fails, the cell is committed to death. De...  Read full blog post.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FANCD2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCD2