FAM62A Antibody

Images

 
Western Blot: FAM62A Antibody [NBP1-84741] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: FAM62A Antibody [NBP1-84741] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
Western Blot: FAM62A Antibody [NBP1-84741] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: FAM62A Antibody [NBP1-84741] - Staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FAM62A Antibody [NBP1-84741] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM62A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ESYT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM62A Protein (NBP1-84741PEP)
Publications
Read Publication using NBP1-84741.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25787254)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM62A Antibody

  • E-Syt1
  • extended synaptotagmin-like protein 1
  • family with sequence similarity 62 (C2 domain containing), member A
  • KIAA0747FAM62A
  • MBC2extended synaptotagmin-1
  • Membrane-bound C2 domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14442
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54755
Species: Hu
Applications: WB
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34980
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS788
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ha, Mk, Pm, Rb
Applications: ICC/IF, IHC-P, ICC
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
6514-SL
Species: Hu
NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-84741
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for FAM62A Antibody (NBP1-84741)(1)

Reviews for FAM62A Antibody (NBP1-84741) (0)

There are no reviews for FAM62A Antibody (NBP1-84741). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM62A Antibody (NBP1-84741) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM62A Products

Bioinformatics Tool for FAM62A Antibody (NBP1-84741)

Discover related pathways, diseases and genes to FAM62A Antibody (NBP1-84741). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM62A

There are no specific blogs for FAM62A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM62A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ESYT1