FAM3D Antibody

Images

 
Western Blot: FAM3D Antibody [NBP1-57064] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM3D Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM3D (family with sequence similarity 3, member D) The peptide sequence was selected from the middle region of FAM3D. Peptide sequence LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM3D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FAM3D and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM3D Antibody

  • cytokine-like protein EF-7
  • EF7
  • FAM3D
  • family with sequence similarity 3, member D
  • OIT1

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-32002
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00007103-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00054600-B01P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89332
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75707
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, ICC, IF
NBP2-24464
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06542
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP1-89395
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75487
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP3-09253
Species: Dr
Applications: WB
NBP1-92200
Species: Hu
Applications: IHC, IHC-P
NB100-317
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-14006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM3D Antibody (NBP1-57064) (0)

There are no publications for FAM3D Antibody (NBP1-57064).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM3D Antibody (NBP1-57064) (0)

There are no reviews for FAM3D Antibody (NBP1-57064). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM3D Antibody (NBP1-57064) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM3D Products

Bioinformatics Tool for FAM3D Antibody (NBP1-57064)

Discover related pathways, diseases and genes to FAM3D Antibody (NBP1-57064). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM3D Antibody (NBP1-57064)

Discover more about diseases related to FAM3D Antibody (NBP1-57064).
 

Pathways for FAM3D Antibody (NBP1-57064)

View related products by pathway.

Research Areas for FAM3D Antibody (NBP1-57064)

Find related products by research area.

Blogs on FAM3D

There are no specific blogs for FAM3D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM3D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM3D
Uniprot