FAM111B Antibody

Images

 
Western Blot: FAM111B Antibody [NBP1-86645] - Analysis in human cell line U-2197.
Immunocytochemistry/ Immunofluorescence: FAM111B Antibody [NBP1-86645] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human rectum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.
Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human skin shows weak to moderate nuclear positivity in the epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM111B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SMKTEENKSFSAMEDDQRTRPEVSKDTVMKQTHADTPVDHCLSGIRKCSSTFKLKSEVNKHETALEMQNPNLNNKECCFTFTLNGNS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM111B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM111B Protein (NBP1-86645PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM111B Antibody

  • family with sequence similarity 111, member B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00000826-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, PLA, S-ELISA, WB
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-01819
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-46617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
538-MG
Species: Rt
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-90824
Species: Hu
Applications: ICC/IF, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB

Publications for FAM111B Antibody (NBP1-86645) (0)

There are no publications for FAM111B Antibody (NBP1-86645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM111B Antibody (NBP1-86645) (0)

There are no reviews for FAM111B Antibody (NBP1-86645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM111B Antibody (NBP1-86645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM111B Products

Bioinformatics Tool for FAM111B Antibody (NBP1-86645)

Discover related pathways, diseases and genes to FAM111B Antibody (NBP1-86645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM111B

There are no specific blogs for FAM111B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM111B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM111B