FAM111B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FAM111B Antibody [NBP1-86645] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human rectum shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.

Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human skin shows weak to moderate nuclear positivity in the epithelial cells.

Analysis in human cell line U-2197.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAM111B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FAM111B Antibody - BSA Free (NBP1-86645) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SMKTEENKSFSAMEDDQRTRPEVSKDTVMKQTHADTPVDHCLSGIRKCSSTFKLKSEVNKHETALEMQNPNLNNKECCFTFTLNGNS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM111B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FAM111B Protein (NBP1-86645PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM111B Antibody - BSA Free

• family with sequence similarity 111, member B

Background

FAM111B, also known as Protein FAM111B and CANP, is a 85kDa 734 amino acid protein with a shorter 81kDa 704 isoform belonging to the FAM111 family. The gene is known to interact with UBC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM111B